SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DFS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DFS0
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000107
Family Ankyrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DFS0
Sequence length 699
Comment (tr|H3DFS0|H3DFS0_TETNG) Transient receptor potential cation channel, subfamily C, member 4b {ECO:0000313|Ensembl:ENSTNIP00000019364} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LEIIELLLSYNVYVGDALLHAIRKQVVGAVELLLNHKKPHGEKQVSLKKVLSVLLDRHFS
DFTPDITPIILAAHINNYEIIKLLLQRGVSIPQPHAVHCNCMECVSCSDVDSLRHSRSRL
NIYKALASPSLIALSSEDPFLTAFKLSWELKELSTVENEFKSEYGELSRMCKQFAKDLLD
QTRSSKELEIILNYRDDSNPLLDENPNDLARLKLAIKYSQKEFVAQPNCQQLLASRWYDE
FPGWRRRHWAAKLLICIFIGLLFPLLCIAYLISPKSRYGLFIRKPFIKFICHTASYLTFL
FLLFLAAQHIASPLCDLQGPPPTTVEWMILPWVIGFIWNEIKQMWDSGFQDYIGDWWNLV
DFIMNSLYIATISLKIIAYVKYSEQKHRNDWEMWHPTLVAESLFAIANIFSSLRLICLFT
VNSHLGPLQISLGRMLLDILKFFFIYWLVLLAFANGLNQLYFYYETERTNKCKGIHCIQQ
NNAFSTLFDRVECLYWRIFGLISLNVTKVEREHEFTEFVGSTMFGAYNVISLVVLLNMLI
AMMNNSYQHIANHADIEWKFARTKLWMSYFEEGGTLPAPFNIIPSPKSVYYLFAWIKKHL
FKRRSAKRLETFETLGRRAAENVRINHEYQKVLKNLVRRYVAAVIRDAKTERSLTEENFK
ELKQDISSFRYEVLGMMKSKPRSQISSKVASSTLAYPGN
Download sequence
Identical sequences H3DFS0
ENSTNIP00000019364 ENSTNIP00000019364 99883.ENSTNIP00000019364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]