SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DG30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DG30
Domain Number 1 Region: 361-429,892-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.2e-40
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 8-126
Classification Level Classification E-value
Superfamily PX domain 4.84e-24
Family PX domain 0.0021
Further Details:      
 
Domain Number 3 Region: 251-331
Classification Level Classification E-value
Superfamily MIT domain 5.23e-22
Family MIT domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DG30
Sequence length 1064
Comment (tr|H3DG30|H3DG30_TETNG) Ribosomal protein S6 kinase polypeptide 1 {ECO:0000313|Ensembl:ENSTNIP00000019474} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MISQRDKGDLARFYTVTDPKKHHKGYTVYKVTARLISRRNPEDVQEITVWKRYSDFRKLH
QNLWQLHKALCSQSELFPPFARAKVFGRFDDSVIEERRQCSEDLLQFSANIPALYNSQHI
QEFFKGGEIHDGSELIGPAEPHADFLADSVSDCSSDGPPSGGDLTSQAVETDSLAGLDDG
MASGRTSPNHPQGEATIPSNSPRLPSLHSPCSPSPAPVSSTPKPEVRPGRSLLFPGSLKK
VGAGASKDVKSDYLDRASELISLAVQKEKEQDFHAAFSCYRNGVDLLLQGVQGEPSPKRR
EAVKKKTAEYLMRAEQIASQHLRSSMGQGSTQTVVIEISSSQSLRSPSEELRAYRVLGII
DKVLLVMDKMTQETFILKGLRKSSDCGRIKRTIVPHSVPHMVQLRKFIVSEDAVFLLLQY
AEGGKLWSHIGKYLRSSSQEGSFDIPFIQKSHTAAIRSPQQAFPPLGADSISSGSAPVAC
PDPASELQKQESCSPSLQKTAPLARPDEESDSGAMSEEEFTNSYLALCNEYEQEKVNADV
LEEQEERSEKEVLSLEVPMGTATTSSRSRSLLSNDSLSSPISSQELGFFPESSKCPLPSP
AVPLTLDQSKHTPMEFFRIDSKDSTGEVNFLDLGEQHISQKSVPIFSTSDLGSDVTEGPP
ELAQEVGLHSGGLWGLDCSDKGSNDSVPVISFKEAAVEDEGHPPDLLVNLPVPSGAVHSS
QEELDTSGVIPGLEAEASPQKFTQPDVLQLLIQPEEEQELPSLHTASATCDTSAASSSIS
SMLEDCSVALGQEKTYQILTCDAARQDVDLPLTDPFNEQHENGTNVNASPGSHPGGGSRS
FSRSTSEAEAHAAQQSSPGLHDEPPRAVCGPRGSEFDKEVSRLFAQLDELSLAASQARIP
EELVKCWAAEMTTALDSLHQEGIVCRDLNPNNILLDHQGHVQLTYFCSWVDVAESCDREA
VSNMYCAPEVGGISEETAACDWWSLGAILFELLTGTSLLRCHPAGIGRHTTLNIPEFVSE
EARSLLEQLLQFNPVERLGAGGAGVDEIKSHPFFVNMDWPNALR
Download sequence
Identical sequences H3DG30
ENSTNIP00000019474 99883.ENSTNIP00000019474 ENSTNIP00000019474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]