SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DGA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DGA2
Domain Number 1 Region: 32-175,207-269
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-50
Family BAR domain 0.00000988
Further Details:      
 
Domain Number 2 Region: 508-583
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-16
Family SH3-domain 0.0000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DGA2
Sequence length 584
Comment (tr|H3DGA2|H3DGA2_TETNG) Bridging integrator 1a {ECO:0000313|Ensembl:ENSTNIP00000019546} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAELNLGKGLTAGKVASNVQKKLTRAQEKVLQKLGKADETKDAAFEEGVINFNKQYAEGS
KLQRDLRAYLEAVKAMHESSKNVQACLADMYEPEWYGKNEVDSIVEDCDVLWTDYHQKLV
DHALISMDTYLGQFPDIKARIAKRDRKLVDYDSARHNYAITHKTKKKDGGIKITKPSSLL
ERATPGWAQGLLSAHNVAQSSLSRSQAEEELERAQKVFEEINIDLQEELPSLWNSRVGFY
VSTFQSLAGFEEKFHKEIGRLDQDLYDILEKLEGTDTSGLKSNNWSNVVLSGNKCSTDLK
PTPCLQKDSVKEASNHTLRPGGPPPIPKSPSRLKPAVPPPPKVTPSKDMKAENIVNLFDA
AAAPDISVTSPTEFDRPAVSSLLDVDLDSFTSTVTETEFQNQGWHFVTELGETCSSTVAA
RSGATPPLLQSSFSLSPSDHSDADDTEPVAEAQEGWGDDGSQPVTEEETPAAEATEEESV
QAATAMDGEEGQPPAAAAQPTEEASEAIEMPPGFLFKVQVMHDYAPNDTDELEMKAGDVV
LVIPFENPDEQDDGWLMGMKQHDWQQNKENAAKGVFPENFTQRL
Download sequence
Identical sequences H3DGA2
ENSTNIP00000019546 99883.ENSTNIP00000019546 ENSTNIP00000019546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]