SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DGF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DGF0
Domain Number 1 Region: 15-161
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-28
Family C-type lectin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DGF0
Sequence length 216
Comment (tr|H3DGF0|H3DGF0_TETNG) CD302 molecule {ECO:0000313|Ensembl:ENSTNIP00000019594} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PLKKKLPFLLLSFIHLQLTLSGDCPADGRTWVPFQDKCYHFVHGAEDQLKSYTYERARSL
CLGFELLSIQSAEENDFAVNYSPDVWKGTVNVWLGMYFDTNSDSLRWSDDSAVKFTNWED
GFSPDLPPMETCAVLHSNTGKWEKVSCLDEVENGVVCEAKQGMPEAEKVKQKSSLVLSTL
VILSVIAVVGVSAGIWCLYQRQNPGSNIFTAFEYHP
Download sequence
Identical sequences H3DGF0
ENSTNIP00000019594 ENSTNIP00000019594 99883.ENSTNIP00000019594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]