SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DGI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DGI5
Domain Number 1 Region: 20-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-46
Family Ankyrin repeat 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DGI5
Sequence length 546
Comment (tr|H3DGI5|H3DGI5_TETNG) Palmitoyltransferase {ECO:0000256|RuleBase:RU079119} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MQPLPVCSASGGDIFDSIQRGNVEECLQFIQNDRSVLKQKGWGGFTPLHYAALHGNRALV
ILFLSNGADTNLACDAGQTAFHFACRQGNIYIIHQMMQHGADLHIRDLQGKTAMHHAVTG
GSIVTVHYLWETGMFHFSDTDMYHVTPLHLAASTSNTEMVRYLLREERCAVEAADHQGAT
ALHVAAERGSAEVCWALLQRGWRALHHRNHSGLTPLDLSRQGKTFRHQQLTKLLNRYINE
PSDHKPRESNVLYYWTLFFPTLGGAAVLLIAAMLGGYGGMICCLLFPWLARSIFSQYHRL
TTYQRLPNPIYLGTLIAGLFHSLLCFYGKIVSVVHSLLVVGLLCKVLIHNPGTLERANAD
PRFSCIADLVAQNQSPHKFCPCCELFLPDCTKHCKLCDRCIEDYDHHCLFLNRCIGRGNH
RLFLVFILSMVIAHLLFLAMAVAYLLERIPPGGRSLSRWLTLLGGEFWVVVLMSINSLTL
LWEVWLLREQFEAVATGTTTYFRQGGSSAGRRSLGQRWGTVLKFLVEGRRRISGVHVGEG
KTAIDI
Download sequence
Identical sequences H3DGI5
ENSTNIP00000019629 ENSTNIP00000019629 99883.ENSTNIP00000019629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]