SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DGN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DGN5
Domain Number 1 Region: 888-1004
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000001
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 257-388
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 383-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000419
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 4 Region: 847-888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000466
Family EGF-type module 0.005
Further Details:      
 
Domain Number 5 Region: 616-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000339
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 1118-1160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000449
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 7 Region: 578-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000558
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 8 Region: 987-1096
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 756-889
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 229-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000903
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 11 Region: 654-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000354
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 12 Region: 116-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000607
Family EGF-type module 0.016
Further Details:      
 
Domain Number 13 Region: 540-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000661
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 14 Region: 154-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000754
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 15 Region: 193-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 16 Region: 691-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000636
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 499-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000013
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 70-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.019
Further Details:      
 
Domain Number 19 Region: 418-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 20 Region: 34-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000159
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 1086-1120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 22 Region: 459-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000274
Family EGF-type module 0.01
Further Details:      
 
Domain Number 23 Region: 1-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000214
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  H3DGN5
Domain Number - Region: 1152-1188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000214
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 730-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000745
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DGN5
Sequence length 1205
Comment (tr|H3DGN5|H3DGN5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000019679} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
PCRNSGICSEGPAGFVCYCPDGFAGVRCHQKESVCSLAPCLNNATCVSKGNESVCRCLRG
FSGKNCEEIIDYCRLLNINCLNEGLCLSVIGGYQCVCSPGWTGEFCQYVGDACLVQPNSC
VNGATCVTTSQPSSPPQYSCKCPLGFTGEYCEAEINECGSFPCQHNGTCVDLLGHYTCRC
PAVGFVGQNCEIDVDACALAPCDNGGRCVLNNASSYTCVCAPGWSGQTCRLNVNDCVQHW
CRNGATCVDEIDGYSCICPGGFTGIYCEQDIDYCVDHHCSQHGVCLDQQNNYTCLCLPGF
EGPLCQLETNECNSVPCAHGATCVDLIRDYRCQCPPGFEVFLCPAGRTCSENPCLNGGSC
VDLINGYICTCPFGFGGAFCELDLDECQSKPCQNGGICADGINLYECFCADGFVGSSCEI
NYDECVHGYCANNSTCLDLVADYECVCLPGFAGYRGADCSSPLNLCKSNPCKPEGTLHCE
ELANTYRCVCQHGHTGPRCQTPIKHCVDGLCQHGSTCEDLSGGFKCHCSAGLKGQFCEIN
VDECEEKPCGILSVCQDALNGYSCFCAPGFIGKNCETEVNECLSQPCGNGGSCVDELNSY
SCQCLPGLTGAHCELNVDECASSPCLHNATCVDSVHGYNCVCVTGFAGSSCELDIDECSS
SPCKNGATCLDQPGPNCFRCHCRRGFTGPRCEINVDECSSSPCFHGFCYDVVDGFYCLCS
PGYAGLTCEQDLDDCINSSCSANSVCRDLHLSYECVCHPGWEGEFCQQETDECLSHPCKN
NATCADLLDGYKCFCSPGWTGVDCGEDVNECDSGPCLNGARCQESDVPGEFSCTCPPCFE
GSRCESDADECASDPCQNGGECADQINSYSCDCKAGFSGPRCEEDIDECAPNPCHNAAVC
QDLVNQFRCICPPGYFGTLCDLDVNECEDSPCLHEGICINTRGGFGCVCRPGYSGPQCNI
DIDECMSDPCHNSGKCIDGTDRFLCLCPAGFAGLRCETNVDECMSTPCLHGSCEDGIFSY
SCLCQAGWTGSRCETNIDDCAAIPCLNGGTCVDLIDKYACFCKDGYTGKTCQDDIDVCSA
AAFSVSLCFNGATCVDGEGSDFTCSCPAGFVGDFCEVDVNECCSAPCHNGAMCQDLINSY
VCHCRPGWTGSHCEDDINECLPQPCNQGICIQNDPGYGYTCFCRPGFVVRFPTLLLLLPP
HCTSA
Download sequence
Identical sequences H3DGN5
ENSTNIP00000019679 ENSTNIP00000019679 99883.ENSTNIP00000019679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]