SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DGS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DGS0
Domain Number 1 Region: 79-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 220-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000538
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 137-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000748
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  H3DGS0
Domain Number - Region: 193-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DGS0
Sequence length 438
Comment (tr|H3DGS0|H3DGS0_TETNG) Fibulin 7 {ECO:0000313|Ensembl:ENSTNIP00000019714} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAPLSPRRSFTCIGILACALVLPPQTCMDKHQVVGVLRQMEKFLKGQEMRFTEGLRIMKS
KLATLQNSVSKMPQAAPTSCPPLGAPAFGTKFGSKHFVGHEVHFTCSQGYHLAGSATRVC
QDNGTWSGVSTVCKVMSQCASNPCQNGGTCVAGLNQYRCTCPQRWSGSHCQHPTQTAPPE
WSVVNDPAFSRRPRCAQVNQEQHCSCDAGFHMSGTTDSSICQDVNECEVYRLDRGGKLCL
HECVNVPGSYRCSCPSGYKLLPDGRSCEDVDECLSQQHNCSRGTTCINTGGGFQCVSPEC
PRSHGNTSYVKTSPFQCERNPCPMDSRSCHLSPKTMSFHYLSLPSNLKTPATLFRMATAA
APGHAGPDSLRFGILGGNSRGFFIMQRSDRQTGELILVQPLRGPQEVSVDVDMSEYSERI
FQAKHVARVHVFVSPYNF
Download sequence
Identical sequences H3DGS0
ENSTNIP00000019714 99883.ENSTNIP00000019714 ENSTNIP00000019714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]