SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DH87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DH87
Domain Number 1 Region: 27-464
Classification Level Classification E-value
Superfamily Sema domain 5.76e-154
Family Sema domain 0.00000000265
Further Details:      
 
Domain Number 2 Region: 465-512
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000523
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 525-594
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000112
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DH87
Sequence length 819
Comment (tr|H3DH87|H3DH87_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000019881} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
ADVLDSMARFSVQERVQLTALTDPVRPREGPCIIGAREALFALDPNDISRQSAIDWPAPQ
DKKKECAAKGKNNQTECFNYIRFLQTYNHTHLYTCGTYAFQPKCTFVNADYFTLSTAPLD
DGKGKCPYDPAKGHTGLIVDKELYSATLNNFLGTEPVILRNLGFQHYSMKSEYLPAWLNE
PDFVGSALVRESSGSKDGDDDKIYFFFSERALELECETELTVARVARVCKGDLGGTRTLQ
KKWTTFQKTRLECCLPERHVSFNHLKAVFTLPGQDWRGTTFFGIFHAQWGDVDVSAVCQY
QIADVKKVFEGSYKEYREAAQRWGRYSGSVPVPRPGACITNSVRESGYNSSLQLPDATLN
FAKKHPLMEDKALARPLLLTKGVNFTKLVVDRVSALDQRAYNMLFIGTAEGWLQRVVVLG
PETHVIEEIQLFDTPQPVDSLTISHSKKYVYIGSRSEVLQLPLANCSRYQSQPDCLLARD
PYCAWDSEGRACVRIDLHRGSTSSLSQDLMLERFSRGKAKFEHSRLRNITVVVGSDMVLP
CQLVSNLARPYWVFNDRELQLGDPDAGGARFDPTLKALVVPDAGQMQAGRYVCYSEEQGV
KFQTERYQVAVVASAPIFMEARAPDSSMGLFWVLVITLGAACLLLLVVALYLRRRLKLAL
GKGADMKPLESTLVYPITLPKEPPTFVPSKMPSDEDRFWETGANYYYSDGSLKIVPGHAL
GPSSVSSTASPSAIPGQPIHSPSRLSLTNIRGSGSNGYIRLNLSTAGEERVSGAGGGGGG
LGNLGMGGNDYSSPFKEELRRTLQQRSVLPDANPEESSV
Download sequence
Identical sequences H3DH87
99883.ENSTNIP00000019881 ENSTNIP00000019881 ENSTNIP00000019881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]