SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DH96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DH96
Domain Number 1 Region: 588-708
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.0023
Further Details:      
 
Domain Number 2 Region: 266-390
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-30
Family Cadherin 0.00077
Further Details:      
 
Domain Number 3 Region: 489-591
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-25
Family Cadherin 0.00086
Further Details:      
 
Domain Number 4 Region: 161-270
Classification Level Classification E-value
Superfamily Cadherin-like 2.17e-22
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 695-810
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-18
Family Cadherin 0.0051
Further Details:      
 
Domain Number 6 Region: 377-487
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-17
Family Cadherin 0.0055
Further Details:      
 
Weak hits

Sequence:  H3DH96
Domain Number - Region: 57-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.00157
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DH96
Sequence length 1021
Comment (tr|H3DH96|H3DH96_TETNG) Protocadherin 11 {ECO:0000313|Ensembl:ENSTNIP00000019890} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
FFVFCFNLMSSVLFLSEFLLQRRSFHTTSSMDSASRLAVLAGLLACLLLLCLAQERDYTV
KEEQPENVRIGNLRKDLDLNLDPNIRLSSPLQFKPVYKTGDVPLVRVEANTGEIFTTNRI
DREKLCSGVFAEKRCYYEIEVAVLPDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPEN
TAINTRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDREQ
KDTYVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFKDSELEVTVPENAPMGTSVAQL
HATDADLGSNAQIHFTFSNQISAGTKRHFSIDGSTGLITVKQSLDRELTPVHKLIVLASD
GSSTPSRATVIVNVTDVNDNVPTIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDAD
LYGKVACYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAM
VLIKIKDENDNVPIFPQPEIQLSIPENNDPSTQLIKLSATDADSEHNAEIIYTLGPDAPE
GFNVDRRSGVLSVGKRLDREKQDRYAFTVIAKDNGSTSLQSNVTVKLIVQDLNDNSPAFT
HPEYNFYVPENLPLFGTVGLITVTDADSGENAVVTLSILNGKDNFIIDPQTGVIKPNITF
DREQQSSYTFMVKAVDGGQPPSSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTNASP
GAVVTRVYAIDNDTGMNAELQYSIISSIIITSRVSPRGLFAIDKSTGNITLQEKIVAADQ
GLHRLVVKVRDLGQPESLHAITLVHLFVNDTVSNSTFIQEQLRKSMETPLDRNIGDSEIT
AQANGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHKVVQKGKQSGEWVSPNQENRQR
SPKSLLLNFVTIDESKPDDPTHEHVNGTLDLPVELEEQTMGKYNWATTPTTFKPDSPDLA
KHYKSASPQPTFQIKPETPVAPKKHHVIQELPLDNTFVVGCDSLSKCSSTSSDPYSVSEC
G
Download sequence
Identical sequences H3DH96
ENSTNIP00000019890 ENSTNIP00000019890 99883.ENSTNIP00000019890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]