SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DHJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DHJ9
Domain Number 1 Region: 775-1064
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.64e-79
Family Complement components 0.0000152
Further Details:      
 
Domain Number 2 Region: 1148-1268
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.22e-27
Family Alpha-macroglobulin receptor domain 0.0021
Further Details:      
 
Weak hits

Sequence:  H3DHJ9
Domain Number - Region: 612-664
Classification Level Classification E-value
Superfamily E set domains 0.0518
Family Arrestin/Vps26-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DHJ9
Sequence length 1288
Comment (tr|H3DHJ9|H3DHJ9_TETNG) CD109 molecule {ECO:0000313|Ensembl:ENSTNIP00000019993} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=CD109 OC=Tetraodon.
Sequence
LTVRGYRGDSLVFSNSTALPFSLRNVSSFIQTDRSCYQPGETVRVRVVSLRLDQRPHKGR
VETRVLDPSGTAVDGREATGTLGMVLWEFSLSQMAPLGQWTITASANGVTDERTFTVEDH
ERPPFEMLFKTPPRVLVGDALSGSVRVLYPSGPPVHGTLVVSVSLASASVPAQTKEVRLQ
IYGSTQFFFGKDLLQSLYSSPGISGGSLRVTAGVTDSSTGLKVTKTVEVQVEEHQFLLQF
HQFPSSLKPSLYFYSTLSIQRYDSGPLGSEDRMHPAVIEVTQELTTMKAEAAILTLPVPE
DGNVHFSFRLKQEVLKLVIRAKFQSSEQTLRVYRNYSSPTGSYVQVSADTLPAQIGVPLQ
LHVESSFQWSELHYVVSSRGLLLAAGTKNSSWFSLTPSVSWSPEACVTVYCVRSDGELIS
DTVAVPTDQPNQASLEWSSPQARPGEQVALTVTAAEARFQVGVVVMGTHGDSPLADVGMN
AKQCFTSSALVFGSTGSLHSPTGVSVSLLPQRCSLRMLTNAMLQKQAQAEGPDGFKFSSS
GSEEGDFLTIETSWRRWMEDAETLLWIDSDVSENIWTSDKMSVPDGFTALRAVALVMSDN
LGLGFTPVPQQLSVTKDFSLALNVPSCLIRGEEIVLEVHVINHLERQMEVILLLAESETF
QFVLANRADASVVNAQKLTLGSHVSAVALFPVRPVALGPMDITVDAVSAEASDSLVWSVF
VKPGGVEQSFSKTLFLELPPSNHSISRSVSFSSPPHVVAGSRRTFVAYAGDILALSISHL
DSLVQRPLGCGEQNMIHFAPSIYVLLYLDKSTQDNQELRSQAVAYLKEGYLRQLSYQRED
GSFSAFGARDPSGSTWLTAFVLRCFLQAQAYMMVSQSVLTRAVTWLLEHQGPRGDFGEVG
RVIHTEMQAGLDDAPAALTAFVLIALLEDERYTGNVSLAQRYLEDKVSGGGLSNYSMCLA
AYALALANSPQAGRALDELRRRADLIDGVMMWSSSAGPPSPDWPPRSAQVEMTAYVLLAF
YRLGNLVEGIGLMKWLSEQRNHLGSFGTTQDTIVALQALAYYAAFSGAKAIDLGLSVSTP
TSPLVSQLHINSTNFLAYQSQEIDAAQDVNLNIYMEGRGFVIFQLNIFYNLDSRAFMQSL
HDAAEEEAFSLDVAVTLEADQNHMLLSICTRLQESQVVRQTGMVMVEAGLLSGFRLSPGA
LPPGSPLRNVEAQEDKVTLYLDSVNRTEVCIRLPLLRAHKVARVQDAVVQVYDYYEPTRR
ATRAYNSDTLRNSDSCFFCGVGCDGCRP
Download sequence
Identical sequences H3DHJ9
ENSTNIP00000019993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]