SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DHZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DHZ4
Domain Number 1 Region: 171-367
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.16e-56
Family Prokaryotic proteases 0.000000854
Further Details:      
 
Domain Number 2 Region: 382-476
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 31-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000581
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 110-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000333
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DHZ4
Sequence length 481
Comment (tr|H3DHZ4|H3DHZ4_TETNG) HtrA serine peptidase 1a {ECO:0000313|Ensembl:ENSTNIP00000020138} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VAQLPSANMFWWLSLCAVAALAEAQSSGRFVVGCPARCDKSTCPRPPADCAAGQTLDACR
CCPVCASGEGEACGGTGKLGDPVCGDGLECSVPGGVAHSGTVRRRSRSGTCTCKASEPVC
GSDGVSYRNTCELRRASRRAQRLLQPPVLFVQRGACGKAQDNPDSPRHKYNFIADVVEKI
APSVVHIELFRKMTYSKREVPVASGSGFVVSEDGQIVTNAHVVANKHRVKVELQSGGSYD
AKIQDVDERSDIALIKIAAPTKLPVLLLGRSSDLRPGEFVVAIGSPFSLQNTVTTGIVST
TQRGGRELGLQNSDMDYIQTDAIINYGNSGGPLINLDGEVVGINTLKVTAGISFAIPSDK
IREFLAESYDRQSRGRTAAKKKYIGVRMMTLTPALAKELKTQHRDFPDITSGAYVMEVIA
KTPAAVGGLKEHDVIISINGQRISSASDVSAAIKKDNKLSVVVRRGNEDLILTVVPVEID
P
Download sequence
Identical sequences H3DHZ4
ENSTNIP00000020138 99883.ENSTNIP00000020138 ENSTNIP00000020138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]