SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DI52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DI52
Domain Number 1 Region: 14-98
Classification Level Classification E-value
Superfamily E set domains 6.72e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DI52
Sequence length 167
Comment (tr|H3DI52|H3DI52_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000020196} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
FPLSPCPPPPAATPCIKAISPSEGWTTGGATVILIGENFFDGLQVVFGTMLVWSELITPH
AIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRHPG
DPERLPKVSHTQTTHTNTHTHTHTHTHTHTHTHTHKLSDCFVFWLTA
Download sequence
Identical sequences H3DI52
99883.ENSTNIP00000020196 ENSTNIP00000020196 ENSTNIP00000020196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]