SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DIA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DIA4
Domain Number 1 Region: 921-1069
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-38
Family C-type lectin domain 0.00018
Further Details:      
 
Domain Number 2 Region: 349-485
Classification Level Classification E-value
Superfamily C-type lectin-like 3.95e-36
Family C-type lectin domain 0.00024
Further Details:      
 
Domain Number 3 Region: 792-916
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-34
Family C-type lectin domain 0.00066
Further Details:      
 
Domain Number 4 Region: 1198-1333
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-33
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 5 Region: 497-635
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-33
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 6 Region: 632-772
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-31
Family C-type lectin domain 0.0001
Further Details:      
 
Domain Number 7 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-31
Family Cysteine rich domain 0.0000212
Further Details:      
 
Domain Number 8 Region: 1080-1202
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-30
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 9 Region: 163-340
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-29
Family C-type lectin domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DIA4
Sequence length 1335
Comment (tr|H3DIA4|H3DIA4_TETNG) Mannose receptor, C type 1a {ECO:0000313|Ensembl:ENSTNIP00000020248} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
VKLHILKIKKSEPPLPFFVSDSGSFLIFNENHNKCIRVESATSITVAQCDPHSKEQQFRW
ASESRVLSLNLQLCLAATDITDWVKVVLFECDESSPLQHWECKNDTLFGLKDRDLHLNWG
NRNERNIMVYKGSGLWSRWRIYGTKNDLCSKGYQEIFTLEGNAFGAPCQFPFKFNSKWYA
ECTMDGRSDKQLWCATEKDYDIKKKWGFCPTEGKRTSGWDTDPVTGVEYQRNAQSVLSWH
QARKSCQQQGADLLSIVELHEQSYISGLTAFLGTSLWIGLNNLDFETGWQWSNGSPFRYL
NWAPGHPSSQPGLNCATLNVGKASKWEKNCNKKLGYICRRGNSTLLPPPLIINQPIFCPN
HWVPYAGNCYYLERNKAMWRDALDACHKQGGDLASIHNIEEQSFIFSQSGYCPQTCCGVG
LNDQRNQMLFEWSDRSPVSFTYWQSGEPSHANNLQEDCVLIRGKEGRWVDHMCEKTFGYL
CKKKASTRPSEGLHEETSPGCKLGWTRFGSYCYNVGSVKKTFDEATNLCSGDNAYLVDVA
DRYENAFLVSYVGLRPEKYFWTGLSNTADKQVFTWTTRRKVSFTNFNVGMPDRKQGCVAM
TTGVFAGLWDVVSCSNKEKYICKKPAEGVDVTTVPPTTAPLSCASGWTPISNRNTCLKIF
KKSQQLKKTWNEALDFCRAIGGDLLSLHSSKDLHNARYRSFSLPGSAWIGFSLSASKGFV
WSDGSASEYENWSYGEPNNHNDDEHCTEIIAQKYWNDRHCDSYNDWICQIRKGTTPKPEP
VKVLEVYNTTEDGWIIYNTTQYFINNNKLDMESARVFCRKNFGDLVIITGESERKFLWKT
ISRSKEGQYYIGMTLNLDKSFSWVDGSPVTFTAWEANEPNFANNDENCVTMYQNMGYWND
INCGSELPSICKRSSDFANTTVAPTVVPIGGCPPEWEAFQGKCYKFVVGNNKNWQDARSH
CIYHRGNLVSILNQREEAFLTTQMVKYNEDWWIGMSDINWEMHFTWTDGKGISYTNWAKG
QPSSGPSGRFSDRELYDCVMMFGGTSKRMGLWKVEDCYSKRAFICKKNRFRIILSPPFFF
FFFTAVAQKMNWDEARRQCQADDADVASILNPYIQAHLTLQISKYNEPVWIGLNTNVTGG
RYKWVDGWRLSFTKWDTNEPKRNYGCVYMDVDRKWKTASCTDNHYSLCKRSPDVAPSEPP
QLPGSCPESTKRRTWIPFRGYCYSFLNSMTDNWAHASVDCIKMGAALVSIEDPQESVFIH
ENLELFQDSSKTFWIGLYKTHEGEWMWIDNSVVDYTNWESQMPNSEACVAISSETGQWAT
TSCSRYRSYICKKAK
Download sequence
Identical sequences H3DIA4
ENSTNIP00000020248 ENSTNIP00000020248 99883.ENSTNIP00000020248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]