SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DIN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DIN7
Domain Number 1 Region: 905-1199
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000711
Further Details:      
 
Domain Number 2 Region: 215-358
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-31
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-28
Family Second domain of FERM 0.00047
Further Details:      
 
Domain Number 4 Region: 23-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-18
Family First domain of FERM 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DIN7
Sequence length 1203
Comment (tr|H3DIN7|H3DIN7_TETNG) Protein tyrosine phosphatase, non-receptor type 21 {ECO:0000313|Ensembl:ENSTNIP00000020381} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVTRIQLLNGEFVEFTLSVESTGQECLEAVAQRLEVRE
ITYFSLWYFNKQNQQRWIDLEKPLKKQLDKYGLEPTVYFGVVFYVPSVVQLQQEITRYQY
YLQLKKDVLEGRISCSLEQAIRLASLAVQADFGDFNRYDSQDFLQKFVLFPIDWIQDERT
LEEATQKVALLYQSFRGLPASEAEMLYMQEVEKMEGYGQESFQAKDSTGTDVTLGSCLDG
IIVKHKNGRPLVLFRWNEINNMSHNRSFLVVELTNREESVQFQTEDMETSKYVCRMCLAR
LKFYKINMSSLQTQPAVINPVRRRSSTRISLPKPQAYMMPPPQLHYNGHFTEPYTSSQDN
LYMNNHNGYYYHSQTSLDCAPLEYGTGGRLRNGSVYSAHSTSSLTNPQHYMQPSPMSSNP
SITSDITRPDYVPSHRHSALIPPSYRATPDYETVMRQKARGPGGGMVSSQDHRQSHSMRN
LNIGNSYAYSRPDPLVYSQPEIRVGHGGTNQHHHYPFHLGSSFHSPSPYPHPTERRPVVG
AVSVPELTNVQLQQAQEYPAPNIMRTQVYRPPPPYPYAHPRPANSTPDLSRHLYVSSSNP
DLVITRRVHHSVQTFQEDSLPVAHSLQEVSEPLFSGAPQRHLYNTQKRNSIELAGLEHSL
EGMRLKERTVSSSAAETATPPPVLRGGRSQGSQLNVFLEHPKKEEVKESIQYGHKKSLSD
ATMLVHSSGEEEELEDDGGRHTPLSQEAAAAALAPEQPSQPHPGLTALPSLPEQQQNPAE
PPPAYPIGSCLEPSITSSITYKVHPMIQESEPLYLLSDLRQASIIPSISEGDLSSQAKQK
TKKEVKKRPVSELPPGKKAVEGLPPPGMKKGPRAEVKKMGPLKMAHLNGLSVSRQPVYSD
TKDEPERASNDERCKLLEQHMERGELLKEYESIPRRHPAGECTVAQLPESSDKNRFHDVL
PYDSTRVELVPTKENNTGYINASHIKLTAGGQEWNYIASQGPLSNTCQDFWQMVWEQGVS
IIAMVTAEEERGREKSYRYWPRLGSRHNTVTYGRFKITTRFRTESGCYATTGLKLKHLLT
GQERTIWHLQYTDWPDHGCPDDLKGFLTYLEEIQSVRRHTNSISDPKNTNLPVLVHCSAG
VGRTGVVILSEILIACLEHNQMLNIPNVLLKLRAQRMMVVQTFAQYSFIYKVLIHYLRNS
RLI
Download sequence
Identical sequences H3DIN7
99883.ENSTNIP00000020381 ENSTNIP00000020381 ENSTNIP00000001310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]