SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DJ75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DJ75
Domain Number 1 Region: 53-461
Classification Level Classification E-value
Superfamily Ras GEF 2.48e-100
Family Ras GEF 0.0013
Further Details:      
 
Domain Number 2 Region: 521-592
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.41e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00088
Further Details:      
 
Domain Number 3 Region: 457-527
Classification Level Classification E-value
Superfamily EF-hand 0.0000000122
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DJ75
Sequence length 762
Comment (tr|H3DJ75|H3DJ75_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000020571} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
THSVARSAPRRRRVAPGCSSKSRVSPPVRPHRFHKPAPAHSAPVKPAMALGHLTKGASWE
ELIQACLQSFDSTGCVCGSSHLLNITLTMHRFLISSSDLLDKLIALYPPAALDHEQPTAC
QKICYFIRHWIREFWMMFRLHHSLSDSLEQFRELIREQGQEHLCALLETRWINERDWSWK
ASQKIKVNTSKKRKVSLLFDHLEPGELAEHLTYLEFKSFCRISFLDYQNYIRNCCMKDIP
AMERSIALCNGISQWVQLMVLSRPTAQLRAEVFTKFIHVAERLHVMHNYNTLMAVVGGLC
HSSISRLKDTTSHVNGDVTKVLNEMTDLLSSCRNYDNYRQAYNRCTGFKIPILGVHLKDL
ISVNEAMSDYVEDSKVNVQKLQALYSHINELIQLQQIPPKLDANKDLVHLLTLSLDLYYT
EDEIYELSYTREPKNCKAPPATPSRPPVVVDWASGVAPKPDPRTISKHVQRMVDSVFKNY
DQDQNGFISQAEFEKIAASFPFSFCLVDKVREGLVSRDEITAYFMRASVICSKLGLGFVH
NFQETTYMKPTFCDNCSGFLWGLIKQGYRCKDCGMNCHKLCKDQVAFECKKNTKATNAVD
SPTTSSTPVAMGSPEVFLLPGSEECSFSPPLDDSKDWSPESPDISCSRPQRVHSCTQTEA
LQLPPSASTEVGGLEPVLPAAPAHTSCPSPVLWRKERHCAQWENREEEHKPTYECLESDN
DRLVKVNETLRVKLREAEWEVEMLKTLLKRQDLHPVAEEDSS
Download sequence
Identical sequences H3DJ75
ENSTNIP00000020571 ENSTNIP00000020571 99883.ENSTNIP00000020571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]