SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DJF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DJF6
Domain Number 1 Region: 65-309
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.61e-49
Family Ankyrin repeat 0.000000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DJF6
Sequence length 666
Comment (tr|H3DJF6|H3DJF6_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000020652} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MGDSARTKRREQLKRWSGSSTDRAPAVARRRWRGAVEDPPGEAEALLGHTATDPKRVRFD
RAAEFLAACASGDREEAELMLKESQDGETEPQEHVEIINCTNADGITALHQACIDGSMEM
VTFLLERDASVNQADSEGWTPLHVAASCGYPDIAEFLLQRGASLSAVNCDGDVPLDIALD
EATESLLQDYTLKQGPGVDLEAAKRLEEEQITRDAQTWLKDGPPADVRHPRTGATPLHVA
AAKGYLQALKILCQCGLDASAKDLDGWTPLHAAAHWGQGEACRILAEQLCNMEARSNAGQ
TPFDVADESVEKLLEELLVKQANWRNERSISARQKQQGSPAANTQSKLRRSSVCRMSSKD
KITVQDQSKEKGVSGGLQLPEERESSSESSPDAESEGSPTESFTNEAEITLKEQDKLSRT
ARVHPSPQTKDPDGQNPSSTDRRKFQAPARDEESESQRKARSRMMLQSRRSTQGVKETER
TEAERPVVTLTPAERDVDAVKQEESEAEKRLAVRDRRRGRRERRSTGLLQPDGEVAQPPD
EAREVPGGDTHISSETPLGGSSADYRSLYFRLLQDNLVLKDKLQEMELLLSQNKVELERL
RQGQSQESISDRPALMELGNFEKLGLQRRAVELEDELKVLGDLRADNQRLKDENAALIRV
ISKLSR
Download sequence
Identical sequences H3DJF6
ENSTNIP00000020652 99883.ENSTNIP00000020652 ENSTNIP00000020652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]