SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DJG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DJG6
Domain Number 1 Region: 3-164,200-314
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1e-48
Family Diacylglycerol kinase-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DJG6
Sequence length 316
Comment (tr|H3DJG6|H3DJG6_TETNG) Sphingosine kinase 1 {ECO:0000313|Ensembl:ENSTNIP00000020662} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=SPHK1 OC=Tetraodon.
Sequence
FAEHQNHARELLREVDLSRWDAVVIMSGDGLLFEVINGLLERADWETAIRTPLGILPGGS
GNGLAASIHHYSGYRLWAAPVGSEELLLSCGFLLCRGLVSPMDLVSVQLTSSPRLFSFLS
LAWGFVADVDIESERYRHLGAARFTFGTLVRLASLRVYKGRLAYLPEARTGSRTSRLVPR
SATGPPDSLLPPLDQPLSPDWAVVPDEDFVLVLAIYQSHLAEDLMAAPGSKLEDGVIHLL
YVRAGISRAALLRLFLLMQKGAHLAANCPHLVYRKVRALRLEPLSPKGVLTVDGELVEYG
PLQAQVHRGLASLITG
Download sequence
Identical sequences H3DJG6
ENSTNIP00000020662 ENSTNIP00000020662 99883.ENSTNIP00000020662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]