SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DKR5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DKR5
Domain Number 1 Region: 120-339
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.09e-44
Family Ankyrin repeat 0.00038
Further Details:      
 
Domain Number 2 Region: 565-661
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-20
Family PDZ domain 0.00000513
Further Details:      
 
Domain Number 3 Region: 459-527
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-18
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 4 Region: 1625-1695
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-16
Family SAM (sterile alpha motif) domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DKR5
Sequence length 1698
Comment (tr|H3DKR5|H3DKR5_TETNG) SH3 and multiple ankyrin repeat domains 1 {ECO:0000313|Ensembl:ENSTNIP00000021112} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AEDAHISMMVFRIGIPDIKQTKCLRFNPDATVWKAKQQVLCSLTESLRDVLNYGLFQPAT
DGHDAKFLEEERLLKEYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKASLKKFM
DYIQTSAVDKMVKFMDKGLDPNFQDSDTGETPLSLAVQCEPSGGEAIRVLVEGGAHIDFR
SKDGLTPVHKAVRGHRHTALLALLSLGASPDYKDRRGLTPLYHTVLTGGETSCCETLLYH
HAKLGIRDENGWDETHQACQHGNSQHLEHLLFYGADSASQNASGNTALHICALYNKESCA
RILLYRGAKKETKNNSGQTPFQVAVMSGHFELGEIIKNHRDTDVVPFVESPKYAPQRRES
ARTLVVPHPHPFLRANSDSSMNLPDWMAVPNAPGTNIVSVQVPPLTQSKLTTKKGYLKAP
CGAPAAPGGHAHVRRPGGGLGIRRTGAGRAEDRATAAPSAGQRRRLYSAVPGRVFVATRS
HSAQGEREISFNKGDRVKVLSVGEGGYWEGTVRGRTGWFPSDCVEEVMHRSQDNRSESRG
ERAKRLFRHYTVGSYDSFDAPSDYIIKEKTVLLQKKDSEGFGFVLRGAKAQTPIEEFTPT
PAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNSLMVKV
VMVTRNPDMDDGSRKKIPQQSKRLSTPAIALRSKSMTSELEEMVSESRRKRVCRSLMSVL
SVPSEGPGRQESCWAPSWICVQESPPYAGKNVAPCRSSGRLQNQDWSGPGKHQPGSLAHG
MQRQKSIAEAELRTELLAGRWPAGLDRHSQVPGPDDIPPPPTTAPPDPPFSSAPPLSPLS
PCPSPRPPLRITNPTPSPCTLPTGAGRGLAAPAPPPLVERRMRGYSTAVPASSIATVIPQ
QQQAAPSQPQRAERAAGAGGPKGGARRGKGPLVKQSKVEDLRTGQGTLGDKGSVEKSSIP
IPTIIVKAPSTSSSGRSSQENLDYTSQFGAAIVGAARRDRERFHEARRKSASLFMSAEED
GAPADNATRLRPSKSIDEACLQPSACPSTPHLLWTTSPSRCPPTSRQPVPSTSTTFIHPL
TGKALDPTSPLGLALAARERALRDDSRLRRQDCSHTPLPASALPGHLQGEGAGEVQGTGQ
GGLHGQGGAGRRQRRPVPAGGPDPAASETLLPQDGKHKEPVLSGFAAHTPLPSPQAGDST
ASSLTSYDSEVANLTQSAHSPCQTSPNPPAPPSPSTLRPNATAAAPPPPSVSPPPPPGTY
HRPFSMSHPHHLYNSAHAPGRSSPTPPPHAVAPPPAYRGPPPPSSTAAASAPLRSAASHA
TTARETVVDSGIEELDSRSSSDHHLDSILALSGARMDRGGAAGGRGGGGGESERGGDFLE
SYMSYFDGQTFEMPSPPPTPKPAGSETGAAPATCRGRPAPPRLPTTPAGSRRTRRRRRRA
RKDRPRTATGAGRPPAWRAPSRRTWSDRAPLRLYPPSPSAKPSVVNELSSKLQQRSKDSA
SALSPPLGPLPVPVPHLPVPAHPVSLAHSGLPVPQLGTLSVSSARSARRSPQRSRSPLSP
TTYSPYPTSPKHRPVFRTKALEFQFIPSRESRKADSQALQRGRAPSPLISPSESPKLGPP
RGPPKPFASKPLPYWTKYDVADWLGYLNLGEHRERFLDNEIDGTHLPSLTKDDYLDLGVT
RVGHRMNIERALRSVIDQ
Download sequence
Identical sequences H3DKR5
ENSTNIP00000021112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]