SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DKT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DKT9
Domain Number 1 Region: 164-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7e-45
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 50-102
Classification Level Classification E-value
Superfamily GLA-domain 0.0000000000000436
Family GLA-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 92-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000641
Family EGF-type module 0.0097
Further Details:      
 
Weak hits

Sequence:  H3DKT9
Domain Number - Region: 125-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000782
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DKT9
Sequence length 421
Comment (tr|H3DKT9|H3DKT9_TETNG) Protein Z, vitamin K-dependent plasma glycoprotein a {ECO:0000313|Ensembl:ENSTNIP00000021137} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MLSSITSAALLCLLAGAGAVAPDRSDPQVFLDKQQASSLISRQKRNAAGSTLEQVCMENI
CTYEQARAFFQDSYRADIFWAVYVDGDQCAEKPCKNGAMCSDSVGGYDCVCKSGFTGVHC
EKDETLCVVDSDKGCSQFCKPGYTSHECSCAQGWKISGSDKTKCVPTGRFSCGRVSSVGQ
WESRMATNKENNFQGISCTSGECPWQALLKTSASPGFCSGVILKANLVLTSAQCARKYSS
FQVAVGKRSTSYEAGERTLRVKRVHVHPRFVEGRPDNDLAVVELSSSITYNKDTIAACLP
EKDFAENVLMKLPTAVTGWEEAKEEPSLQGPLMLNHLTYVSLADCLEAHPNLLTNKMGCT
LPLANANCTMGSGSPLLTVYKEVLFLTGVVSQPAGADCSKGYIVQKVSRYQSWLQSLMNL
R
Download sequence
Identical sequences H3DKT9
99883.ENSTNIP00000021137 ENSTNIP00000021137 ENSTNIP00000021137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]