SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DL01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DL01
Domain Number 1 Region: 111-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.89e-26
Family BAR domain 0.0059
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-21
Family DBL homology domain (DH-domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 442-501
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-17
Family SH3-domain 0.00034
Further Details:      
 
Domain Number 4 Region: 346-428
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000254
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DL01
Sequence length 506
Comment (tr|H3DL01|H3DL01_TETNG) Rho guanine nucleotide exchange factor (GEF) 38 {ECO:0000313|Ensembl:ENSTNIP00000021199} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RKIYEQEGKPNLLDMGSLLIKPVQRVMKYPLLLGELWQATPEDHPDYRPLQEALTAIKII
NVNINEFRRRKDIVMKYKRVEDESTLRGKESNHRKEEKNTPNKKNLIFFFEPQVRDEIFD
REEKLFRSEKAVRLLVKNVHWYLQHAQELVSVAVQNVLDMGDIVKEPTKNGMAHSSHSNG
NDPYKHFKDSMECSVLVPLTSLQGMFTGPQKLIQKRYDKLLDYCSRLEPTTDETSGPARR
DYEALNAMLVEELQRFNMAAFTILNNSVVNLVTLLLRLIDMILAGSPSIHQLPAPLSNSA
EVQNSIMEELNNLTFVKDNAQKLMERKVSFERQRDKKMTMPEVQHQTEEQRARLLAEHPV
SRLYQLKRKCNGCQEQDLSLLEGELVALLEDTDPSGSSSRWLVHTGGSQGYVYSTFLKPY
NPLRDSQRWGQTCRDQQNFRSFSENQFYAVYAFQARSDQELTLQEYQHVRILQFSDLGGN
KDWWLAECNGQRGYVPANYLGKMSYA
Download sequence
Identical sequences H3DL01
ENSTNIP00000021199 ENSTNIP00000003168 99883.ENSTNIP00000021199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]