SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DL32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DL32
Domain Number 1 Region: 31-79
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000735
Family Ovomucoid domain III-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DL32
Sequence length 79
Comment (tr|H3DL32|H3DL32_TETNG) Serine peptidase inhibitor, Kazal type 4 {ECO:0000313|Ensembl:ENSTNIP00000021230} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MTGRAVFLGLLLICVTADAGKSGTLRKPSCPDSEQIMACPLNLAPVCGSDGNTYANECTL
CVERQMTKMDILIVKEESC
Download sequence
Identical sequences H3DL32
99883.ENSTNIP00000021230 ENSTNIP00000021230 ENSTNIP00000021230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]