SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DLR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DLR7
Domain Number 1 Region: 57-424
Classification Level Classification E-value
Superfamily L domain-like 2.31e-60
Family Ngr ectodomain-like 0.053
Further Details:      
 
Domain Number 2 Region: 557-653
Classification Level Classification E-value
Superfamily Immunoglobulin 7.76e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 644-738
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 4 Region: 455-559
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-19
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DLR7
Sequence length 847
Comment (tr|H3DLR7|H3DLR7_TETNG) Leucine-rich repeats and immunoglobulin-like domains 2 {ECO:0000313|Ensembl:ENSTNIP00000021465} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
CPAPCSCLKGQEDKIILDCNRKRLSTAPLDPPSVITQVYVIKYVFLKSLYYAVVKTVFEN
SMNHNELTGVPYLGDVTSNITSLSLVHNRISDVFMNELQPYVSLETLDLTSNSISEIRAG
SFPTMLLKYLNLSNNKISVLEPGCFENISSSLLVLKLNRNRLAVLPSRLFKLPQLQFLEL
KRNRLKIVESLTFKGMDSLKSLKLQRNGITTLMDGAFFGLNNIEELELEHNNLTEINKGW
LYGLRMLRVLRVSQNAVGVIRPDAWEFCQKLEELDLSFNHLTRLEETAFVGLGLLQSLNL
GENAISYLGEGVFGGLTSLCTLDIRNNEISWAIEDSIGIFDGMKKLKTLILQQNKVKTIT
KKAFEGLEELEHLDLGKNGIMSIHPEALSQLRLKVFVLNTSSLLCDCYMQWLGPWLTDNH
FQHSVSAACAHPASLFGRSVLSVSPELFVCDDFPKPHISTHPETSVVLRGNNVTLSCVAS
SSSDSPMTVAWRKDGEVLYDAEVQNYARYQDKELIYTTELHLLDVNFTDEGRYQCVVSNH
FGSNYSTRAKLTVNEMPTFLKTPMDLTIRTGTMARLECAAEGHPSPQIAWQKDGGTDFPA
ARERRMHVMPDDDIFFIANVKTEDMGVYSCTAQNAAGSLSANATLTVLETPSFMRPLEDR
TVARGETAVLQCIAGGSPAPRLNWTKDDGPLLLTERHFFAAANQLLIIVDAGPADAGKYT
CIMSNTLGTERGHIYLSVSPSSNCETGAMYDQDGWTTVGIVVIVVVCCVVGTSLVWVIVI
YHMRRKSEDYSITNTDEINLPADIPSYLSSQGTLSEPQEGYSTSEAGSHQQLMPPFSNGY
VHKSTDG
Download sequence
Identical sequences H3DLR7
ENSTNIP00000021465 99883.ENSTNIP00000021465 ENSTNIP00000021465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]