SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DLS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DLS4
Domain Number 1 Region: 281-439
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-42
Family Phosphotyrosine-binding domain (PTB) 0.0034
Further Details:      
 
Domain Number 2 Region: 65-133
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000353
Family SAM (sterile alpha motif) domain 0.0067
Further Details:      
 
Domain Number 3 Region: 142-199
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000118
Family SAM (sterile alpha motif) domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DLS4
Sequence length 478
Comment (tr|H3DLS4|H3DLS4_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000021472} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LAGRCGSVSNCRSAQPSMARMPSFASEWDEIEKIMNLIGAGIETPKAKQQAPSSADGACG
KALDQPVGEWLEHVGLPQYESKFLLNGFDDLRFMFFTRRENNVMEDQHLRDVGITDPGHR
KKILHAARSLPKVKALGCDGSTSLASWLDSLGLHEYLPNFLSNGYRTLECVKNLWELELV
NVIKISALGHRKRIIASLAERPYEEAPSKSRRLSPVLFHDLLSQSTSPLGQLDPYTSRSM
DMLLPLADSDRRRRALEQDCSISLRSFSERPRSVERHSDRHKESRSNLRLPSQSATYTTV
SAWHHLPEKLILDSCGYEATYLGSMIIRDLRGIESTQDACAKIRKSKDSRKGPFVILSIT
YRGVKFIDAATKTIVAEHEIRNISCAAQDPDDLCTFAYITKDLKSGHHFCHVFSTVEVTQ
TYEIILTLGQAFEVAYQVAVQSRARQFIPPSSLHSEVVETKTSRPVCPSWSSMRRSAV
Download sequence
Identical sequences H3DLS4
99883.ENSTNIP00000021472 ENSTNIP00000021472 ENSTNIP00000021472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]