SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DLW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DLW9
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.74e-20
Family FHA domain 0.0028
Further Details:      
 
Domain Number 2 Region: 112-178
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000262
Family DNA ligase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DLW9
Sequence length 752
Comment (tr|H3DLW9|H3DLW9_TETNG) Nibrin {ECO:0000256|PIRNR:PIRNR011869} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MWVLIPLQSEGQTHYLPPGKEYVVGRKNCDVLLTSDQSISRAHAQLVPNNQKTKTRGTTA
STQGMTLKDSSKYGTFVNSQRLTGNTAVDLKSGDSVTFGVFESKFIVEHLKPVVCSSCLD
PNGKAVLSQSLAALGGELVNSWSLECTHLVMTSVKVTVKTISALLCCVPIVKPEFFSELS
RCVQQKLPPPKAERFIPEIDEPSLLKEEINIGVIPGRKTIFTGKTFLFLSAKQLKRLSAA
VGFGGGRSLLLEEGSLPRQLLECPQSCLIDVTTGSSQALAPSSTTEWAKAVKNVVQRKGL
RVIPESEIGLAAIYASCDRHCNPSHRSVPKVNPRIASASLSQSPAVDETVLPAASQNMTA
YAVNTQTQGDRPHVQSWTIGERSQQRRQADRRSSLRPDWKVTASLSEKPSCHSTFLRLCC
CAVCASLSSDIDSSLTKLPDKAKAPAQVSPQKQSTLTSFFQPVNKKRSSTRPLQDEPSMS
DPKRAALESPVTVRSPNASDSQKTPRNSAAHLCPGQPEGRRDSFSLSAQEELNNRKRKEM
EEDIEMDELESIMSLDMDFFDELPAESHQAQTSTQSSHEKKHSVDTAEASSAKHGSTYGE
ASKRPQTSSSTTHTNTKAFEDDEPEEETKIPMKAVTIKQEVQQAEIDENLPKQLVVVEYR
SLTVAEGPKEKPQKVPDASCKKNFKSFRKHSVPGMRGSPDVIAGADLLVHNRGRNSDLDE
WLKDAIEEERQSRRDENVGDDLFRYNPTKPSR
Download sequence
Identical sequences H3DLW9
99883.ENSTNIP00000021517 ENSTNIP00000021517 ENSTNIP00000021517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]