SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DMV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DMV0
Domain Number 1 Region: 14-97,136-401,486-544,572-585
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-31
Family LacY-like proton/sugar symporter 0.031
Further Details:      
 
Domain Number 2 Region: 408-460
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000804
Family Ovomucoid domain III-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DMV0
Sequence length 606
Comment (tr|H3DMV0|H3DMV0_TETNG) Solute carrier organic anion transporter family member {ECO:0000256|RuleBase:RU362056} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RRARGLLDNIQLFVLCHGLLQLSQLLYSAYFKSIITTIERRYGLSSYSAGSLSSLNEISN
SALIVFVSYFGDQVHRPRLIGVGGLLMAVSATVLTLPHFLSQPYEYDSVLHNQRDLCNMH
TNQSEPTCGREESRQMDENQNLWLLMASAQLLFGVGSVPIQPFGLSYIDDFAGPGNSALY
IAILFSVSVFGPAVGYLLGSVVLQFYVDLDKAALGAQQELHQGDPRWVGAWWMGLLITTG
FLILTSVPYFFFPRSMPSKHGVRQTQAVRRKSDTRRPERSVQAHLKRFPRMLLHLLLNPL
FLLLVLAQCCFSSVIAGLSTFLNKFLEQQFGASAAYSSLLVGALNLPAVAVGMLLGGVIM
KRVGLTLKTIPRFSVVMLTTSLLLCVPLFFMGCHTHEVMEVNHLQGSLCSTNCSCLKSAF
NPVCGSDAAEYISPCHAGCTNFTKDPNNSHRVQLYTQCTCVGGSQSQARPGPCPNSCPQF
LIPAILVISLAALIASITHNPLYMMVLRSVASEEKSFAIGIQFLLMRVLAWLPAPALFGM
VIDTSCIWWKQVCGKKYSCGYYDNITLRNRYMGLQVSYKMAGILLLMVLGWKAQRTQEYC
LEKGHC
Download sequence
Identical sequences H3DMV0
99883.ENSTNIP00000021848 ENSTNIP00000021848 ENSTNIP00000021848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]