SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DMV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DMV8
Domain Number 1 Region: 149-431,514-632
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-70
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0019
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily UBA-like 2.75e-16
Family UBA domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DMV8
Sequence length 1062
Comment (tr|H3DMV8|H3DMV8_TETNG) Ubiquitin specific peptidase 28 {ECO:0000313|Ensembl:ENSTNIP00000021856} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LINQLKEITGIQDPQLLLSALNASQGDVGQAVGLLTSQPLEVRDPGDPQESKSTDETWRA
QKGAKPFLETFQKMLSSVITVVGLPKDELQTAIELSLQESHNAQQEEKDLNRVLEASAEE
NLARMKRMKRSEGQGDMSSPADWIRQDDWPVGIRNVGNTCWFSAVIQSLFHLPVFRRLVL
NYRLSERILEKCKSHSDKRNIAFMQELRCLFALMVGSTRRFVDPSAAVELLRDAFRTSEA
QQSFQDVSEFSHKLLDWLEDAFQLAANGSHAADKQQNPMVQLFYGTFVTERKLEGKTLCN
IEQFGQYPLQVNGFNNLYECLEGAMVEKEIESLHSDHSVASGRERWFEKLPPVLTFELSR
FEFNTQLGRPEKIHKKLEFPQVIFMDRYLHKNIKQTHERRGEVKKLKEELAALQQKLECY
RNYGSGPTKYPLADMLQFVLEFATTKPTNGSTAEDPRPSSPSPSLTGQPVGEAVCQDSRD
TDPPEALVSSCQRTPIYKPFTQCRPPIECPPHPAPHSISEEELHFVKTCLQRWRAEVEND
INELKANMDRLGQMLESMYSDNRLCQVPYRLHAVLVHEGQASAGHYWAYIYDHANQRWMK
YNDINISESSWEELERDSFGGLTNASAYCLMYIDDRLPDLITDDTDDETGQVLHGLDSLP
SVLRRYVGEDNRWFQQELSEWEEQISPQGESTSSAEPPQPSPEHLPQTVVEPAPQSGPPS
EEPEQRASPEPEPETGDRGEHSEREEALLLQANMMLTPAMQGVILAIAKARQTFDHQGPE
AGLIKAFHEEYSRLYELSQEETTPQEDPRLQHVLVYFFQNKAPKRIIERTLLEQFTDRNL
SFDERAVSIMREARSKLRLIKPEDMDMDEYLQWHDDYKLFRTVFVYLLTGLEHYQNQKMR
EALTYLAHAGEINSSLLEKGETFAVDQTVITVFRRKCLTALNESATQLFCSGNDASVDEG
VAIMDEVVIPCLHLMSRDPALSQEDQEAMEGVRSHWCSCLSRSMDDLLQVKLGEFLPRVL
DSSADSVVLKDPPQVHVNQAHDLCSRLAAVMESIHKSSVVIV
Download sequence
Identical sequences H3DMV8
ENSTNIP00000021856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]