SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DMZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DMZ0
Domain Number 1 Region: 136-451
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-120
Family Transglutaminase core 0.00000000197
Further Details:      
 
Domain Number 2 Region: 2-134
Classification Level Classification E-value
Superfamily E set domains 5.25e-39
Family Transglutaminase N-terminal domain 0.0003
Further Details:      
 
Domain Number 3 Region: 556-656
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.58e-28
Family Transglutaminase, two C-terminal domains 0.000043
Further Details:      
 
Domain Number 4 Region: 460-554
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.49e-26
Family Transglutaminase, two C-terminal domains 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DMZ0
Sequence length 657
Comment (tr|H3DMZ0|H3DMZ0_TETNG) Transglutaminase 2b {ECO:0000313|Ensembl:ENSTNIP00000021888} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
AALDIDHFDLECEYNNVEHRTDLNGIDRLIVRRGQAFSIRLYLRSGSYQPGVSALDCIAE
TGPQPSEQYGTRAVFGLSAIINNSCWSAAVTSPPGDTLALSICSAPDAPIGRYSLTLGQL
TRIEFILLFNPWCPGDAVYMENERSLEEYILSQDGIIFRGTYKYPVPLPWNFGQFESNIL
DICLRTLDMNPKYLRNPGKDCSGRRNPIYVSRVLSAMVNCNDDDNGVLLGKWTDGYEGGV
SPLFWRGSVEILHNWDTQSCQPVRYGQCWVFAAVACTISRALGIPCRVVTNYASAHDTNG
NLVIERYIDEKGDLVRSGEMIWNYHCWVESWMTRPDLKSDFNGWQASDPTPQEKSDGVYC
CGPVPVKAIKEGELLLKYDAPFVYAEVNADVNTVMQKKDGSTSKVNTTTFVGQKISTKSI
GSDVREDITHLYKYPEGSEEEREVFKKANHHNKLLQQQQNQGLHIAIKVGTDMRKGCDFN
VFAVVTNNTHSEKKCRLVFGSCAVSYSGQVGGNCGFKDLLNVELAPGGEREVPLRLNYSK
YGNQLTDDNLIRLAXDPEIKIRILGEPKQNRRLAAEITLQNPLPEPLQDCCFSIEGANLT
GGQVISERLNSCVGPGEDAKVKIYFTPTHSGLRKLLVDFDSNKLCHIKGFRNVIIGK
Download sequence
Identical sequences H3DMZ0
99883.ENSTNIP00000021888 ENSTNIP00000021888 ENSTNIP00000021888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]