SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DN35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DN35
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-27
Family Laminin G-like module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DN35
Sequence length 1682
Comment (tr|H3DN35|H3DN35_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000021933} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
DVDLLQKLGLKGEKPSRPLPAGIIPFRSGVILNQRAQIETQLRSLLPASIWANLSLVLSV
RSHRVNSAFLFTLLSERKKLLLGLQLTPNNLVLHTGPNTSVTLPYEPHDGQWHQLAVGIN
GHKVTLYASCGERSVNADFGWDSQEGLTPELQGTLLLGRTSQQQGSAHFEGAICQFDLVP
SAQAAHNYCRYIKKQCREADIYRPNLSPLLPIIPRDKNITITAATPKSGGLDAAKKPTRL
SLARSVAAAASAVRYVAPTQTIKPAPWTTPTPLLGTVMPVTVKFGLVSPPPKAKTETVTV
PLKIRVPPTKPPSSRPSTSKVLSQKTPKPTSTKPTQGNITKKTVGVTDKKKPALPATTST
KLTRTKTKSSLSEQGILPKKPQPATTKKTPPKPKTTPSKATPPKTKTDSAKTVSSKTTTS
SKTTSKQDIKPTKQAKTTKAPVTPRPTRRSYISVTPPATDGFQSWEVPPTQFSLLAGPVG
QKGDQGPSVRLESLGPYGDMNHSVTLFPTKLKSLLALTYLCFCPCRYIQKTHLCRGALKL
SPFSNIDYGPDVFPLSGSVTVLLFMENSPPCRSYGFPGPPGKPGLPGKRGARRTHGSTGL
SSPQYENCVGVCGRSNTALNQRPDPSRSPKVVHQGKKGDPGMSPGPAPKGEKGQKGYLGP
PGLPGEPNISHHPFGVPRQGRQIRFACYEGLPELISFARAKSKYGIPGEPGKRGKMGRPN
EPEPFGEKKNLHSGGLYGEMGAPGPKGVLGLIGDMGPLGEMGCPNFNSTDNILFTAFIHS
LFKSKGEIGNPGEQGEIGFKGDKGILGLPGLPGVRGKPGPQGKIGEKGPDGSPGRPRVQG
FPGDMGSPGENGHEGPKGKPGLRGLPGPRGLPGLEGDEGPIGPPGLSGLEGRIGRKGFPG
KVGAEGLKGEPGVAGSIGSTGERGLVGFIGPVGEVGHSRREGDRGETGLPGPPGEKGPTG
HPGIPGETGPVGPPGRPGPPGATGPAGVRGPKGLRGAIGPDGPTGESGLEGKKASDGPPG
KLGFPGPQGKIGEPGEPGPKGFPGVQGPSGPLGDKGIAGVPGLPGPPGTVGLLGEVGQKG
PPGKAGEPGLPGEPGEKGDIGNAGNIGEQGLIGQRGEPGLEGEAGPAGPDGAKGDKGDTG
QEGDKGEKGETGLKGKEGPPGSPGLTGVRGPEGKPGKIGERGKLGSKGAKGHQGHLGETG
SVGKTGPPGFVGQKGSRGTIGHVGAPGRMGQQGEPGIAGYEGHQGPQGPIGRLGPKGEKG
EQGDDGKVEGPPGPQGDIGPSGDRGERGEPGDPGYKGQVGEDGSKGMPVRQNGRIFFYWL
CEYMHNVLMMCIQGEQGDDGETGSAKAGSRGKMGIPGLPGEQGSIGPKGDRGLRGQNGPP
GKRGFKGGMGLPGPQGDAGTKGQPGDTGEQGFPGILGGFGPKGPPGDFGPKGIRGPKGPQ
GTMGRGGVVGPVGIIGPGGSAGPRGEKGNRGETGFQGPRGSPGPRGPPGPPGRPAVPASF
QEDGLLFMDSHIPLRTENKPVMDLPILDQGAEIFKTLHYLSNLIQSLKNPLGTRDNPARI
CRDLHSCEQKLNDGTYWIDPNLGCSSDTIEVSCNFTGGGQTCLKPVTASKLVFSAGRVQL
NFLHLLSSEAVQHITIHCLNTSVWRSAEAPTATQGSVRFKAWSGEVFEVGGELEPEVIED
SC
Download sequence
Identical sequences H3DN35
99883.ENSTNIP00000021933 ENSTNIP00000021933 ENSTNIP00000021932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]