SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DN58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DN58
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily vWA-like 2.78e-50
Family Integrin A (or I) domain 0.00053
Further Details:      
 
Domain Number 2 Region: 235-347
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000115
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 3 Region: 194-233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000739
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  H3DN58
Domain Number - Region: 355-383
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000798
Family Chicken cartilage matrix protein 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DN58
Sequence length 383
Comment (tr|H3DN58|H3DN58_TETNG) Matrilin 3b {ECO:0000313|Ensembl:ENSTNIP00000021957} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
CRNGPIDLVFIVDSSRSVRPTEFEKAKEFLQDLVDSLEVGLDSTRVGLVNYASTVRMEFP
LKAHFSKPALNALARVEPLASGTMTGLAIRTAVEKAFAAEAGARLNSTKVARVAVVVTDG
RPQDEVERVSAAARESGIEIYAVGVDRADRTSLRLMASQPHEDHVFYVETYGVIEKLTSR
FRETLCGLDACAEGHSCQHLCVDHGSSRGCECRPGFVLNPDRRTCSRSAACVRGHGCQHV
CVRNEDLQVCLCHEGHVLNADQRTCSRIDPCARRHDCQHICISNHDSYVCQCPAGHVLNP
DNKTCSRLDACVQGHHCQHRCVSSGNSYVCRCRPGYSLNTDRKTCTPPSEELRSEIAEDA
CMCEAQIRFQEKVQAAFQDLNRK
Download sequence
Identical sequences H3DN58
ENSTNIP00000021957 ENSTNIP00000021957 99883.ENSTNIP00000021957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]