SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DND5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DND5
Domain Number 1 Region: 9-252
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.75e-54
Family Ankyrin repeat 0.000065
Further Details:      
 
Domain Number 2 Region: 872-1030
Classification Level Classification E-value
Superfamily PH domain-like 3.96e-46
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DND5
Sequence length 1095
Comment (tr|H3DND5|H3DND5_TETNG) Ankyrin repeat and sterile alpha motif domain containing 1B {ECO:0000313|Ensembl:ENSTNIP00000022034} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LCSMWKGLNVNCTDSSGYTPLHHASLNGHRDVVLKLLQYEASTNVEDNKGCFPLHLAAWR
GDVDIVRILIHHGPSHCRVNQQRPSANVLTLEEGREAGSLPPSVLPQNHEKETALHCAAQ
YGHSDVVSVLLHELTDPTMRNSRQETPLDLAALYGRLEVVCMLINTHPNLMTCHCRRHTP
LHLAARNGHHSTVQTLLQAGMDVNCLTDNGSALHEAALFGKMDVVRLLLDSGIKTNLRDS
QGRTALEILREHPAQKSQQITALIQGCHCTGTNDPLIGDQKGHARTPTPTRTYAALPLSD
DAVTSELSKLLHEIKKCRDRDYSFEELCQTISSHSMDSFGSGRLSDEERPDRPNGTLTRV
FKPEGLQRPTPPVAPALEEDEAEKSDPKYSSEIVTSPSLDVFLPEDEDNPYESVTTAVTR
KPCSLDISHRLNACPGNERNRSAEDRRKSHIPEEFAGLLHGSSPACETLETPYHLYSPKP
HSYASTDPQSGLLQAPEFSVVIGGGPRHPFSRTGAESNPGQTEKPQVVYRTIFHTQVNQG
SGYEERACTLGRMRSMPRSVLDLQLSKSLSKSDSNLVAVSPIQEEHSWGSGSREHGAGSL
SPGEGTSPGGRLERTPSFTAEWEEIDKIMSSIGAGIRSGLDFKEENSGSRASRMYGEGRA
GWRSTIWLQKHTDECSAPAFMNDKFQGSNVVEDQDLREGGMNMQASKQRWGSGVQLPRLE
RGLEPEGSLCWLASSHQHPFIFPHAMSCCGSVAMVTVELEAEAATVVEVLKISLIGHRKR
ILASLGDRLHEDTPQKPPRAISLREPGNQTPPQLSPSVGQAAYTAGVPGGSLDVQHLIMQ
ADARRRQRSNDNYFEDVPRSKLERQMAQAGEWCEPITLRPPNEATSSTPVQYWQHHPEKL
IFQSCDYEAYYLGSMLVKELRGESTQDACAKMRKSTEQMKKVPTIVLSVSYKGVKFIDAT
NKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSSHHYCHVFTAFDVNLAYEIILTLGQ
AFEVAYQLALQARKSGHGSSTLPESFDSKPSKPVPKPRVNIRKSMEQPSMDQKGHANVPW
IVEPGQEAKRGVNTK
Download sequence
Identical sequences H3DND5
ENSTNIP00000022034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]