SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DNG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DNG1
Domain Number 1 Region: 581-873
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-67
Family Ankyrin repeat 0.00000913
Further Details:      
 
Domain Number 2 Region: 114-403
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-62
Family Ankyrin repeat 0.0000277
Further Details:      
 
Domain Number 3 Region: 1037-1240
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.91e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0016
Further Details:      
 
Domain Number 4 Region: 447-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.21e-30
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 958-1019
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000353
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DNG1
Sequence length 1258
Comment (tr|H3DNG1|H3DNG1_TETNG) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAASRRSSQQQQQQNSLQSPPRNSSVSAAPPASPPMALLTSVVGPPENERECSVGIEMSL
ASPDLPAPTLANSTSFSTTASGGGCSSSSVSSPGSGAASPTDGSSSIGGAFRELFEACRN
GDVSRVKRLVDSVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLQTGANVHARDDGGLIPL
HNACSFGHAEVVSLLLCHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNT
DGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPL
HLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHFEVTELLLKHGACVNAMDL
WQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSAVDMAPTPELKDRLTYEFKGHSL
LQAAREADMAKVKKTLALEIISFKHPQTNDTALHCAVASPHPKRKQVTELLLRKGANIND
KNKDFMTPLHVAAERAHNDILEVLQKHGAKVNAADTLGQTALHRAALAGHIQTCKLLLSY
GADPAIVSLQGFTAAQMGNEAVQQILNENVPTRNSDVDYRFLEAAKAGDLDTVQQLCSPQ
NVNCRDLEGRHSTPLHFAAGYNRVAVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVA
ELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNIPLDMVKDG
DTDIQDLLRGDAALLDAAKKGCLARVQKLCSPENINCRDTQGRNSTPLHLAAGYNNLEVA
EYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQK
GRTQLCALLLAHGADPTMKNQEGQTALDLATADDIRALLIDAMPPDALPSCFKPQATVVS
ASVISPASTPSCLSAASSIDNLAGPLTELAAAAVSTGSSGVADGATGSERKEGEMTMLDM
NISQFLKSLGLDHLRDIFEREQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
QQGANPYLTFHCASQGTILIDLAPDDKEYQSVEEEMQSTIREHRDGGNAGGVFSRYNIIK
IQKVVNKKLRERYTHRQKEIADENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFG
AGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYLCHRQMLFCRVTLGKSFLQFSAMKMA
HAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQILKPESTAQSAAGAEQKS
Download sequence
Identical sequences H3DNG1
ENSTNIP00000022060 ENSTNIP00000022060 99883.ENSTNIP00000022060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]