SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DNH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DNH5
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-47
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 218-412
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.3e-43
Family BAR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 572-632
Classification Level Classification E-value
Superfamily SH3-domain 1.21e-16
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 4 Region: 463-543
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-16
Family SH3-domain 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DNH5
Sequence length 632
Comment (tr|H3DNH5|H3DNH5_TETNG) Dynamin binding protein {ECO:0000313|Ensembl:ENSTNIP00000022074} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
IEELLQTEQDYVKDLQMCVVEIIEPLQKKQLKNVDFDGLFGNIGSVIDLSQRLLDALQET
DFIGKTFLDFKAELEEVYKIYCQNHDDAISLLESYEKEESIQRHVLQCLERLRGKTNYIN
LGSFLIKPVQRVMRYPLLLMELLGATPESHPDRPELTKALQAVKEINVNINEYKRRKDLV
VKYRKGDEDTFIEKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDEAEKKFRLQE
RLIKSFIRDISLYVQHIRESVSVKVLAAISFCDIYTERSILDPERFQRAHRCISDKQFTQ
FKERTEVLVINPLTQLLLMFAGPHKLIQKRFDKLLDYDNCKERAERLKDRRIQEELQVAR
NNYEALNAQLLDELPKFHTTAEELLTGCVRAFAQAQKDFMKTTLVFYQSWKRGEPDCPVP
GFSFCPENLPPATSTKKPFEKKTLEKQTSKKQLAGPPNCSVQTDEQRAALLVRYGPEKLF
QAERNFNAAQDLDVSIQEGDLVGVIKQQDPMGSNSRWLIDNGVAKGFVYSSFLKPYNPRR
SQSDVSIESQSSNESGYGGSSPVFSRQNSNSTLTFNQIYYALYSFKARCSNELSISANQR
LRILEFQDMNGNSDWWLGEADGRRGYVPSNYI
Download sequence
Identical sequences H3DNH5
99883.ENSTNIP00000022074 ENSTNIP00000022074 ENSTNIP00000022074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]