SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3DNK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DNK6
Domain Number 1 Region: 3075-3339
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-51
Family YWTD domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 1411-1652
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-47
Family YWTD domain 0.00000701
Further Details:      
 
Domain Number 3 Region: 345-608
Classification Level Classification E-value
Superfamily YWTD domain 8.24e-38
Family YWTD domain 0.0000244
Further Details:      
 
Domain Number 4 Region: 696-920
Classification Level Classification E-value
Superfamily YWTD domain 1.16e-35
Family YWTD domain 0.0000669
Further Details:      
 
Domain Number 5 Region: 1700-1961
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-35
Family YWTD domain 0.0000884
Further Details:      
 
Domain Number 6 Region: 2018-2282
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-31
Family YWTD domain 0.00016
Further Details:      
 
Domain Number 7 Region: 218-233,268-336,601-657
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 2353-2521
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-16
Family YWTD domain 0.00042
Further Details:      
 
Domain Number 9 Region: 1219-1260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 10 Region: 1307-1384,1649-1693
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000118
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 11 Region: 2610-2652
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 1972-2011,2297-2334,2519-2583
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 13 Region: 2733-2771
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 14 Region: 2862-2904
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 15 Region: 3020-3068
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 16 Region: 132-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 17 Region: 3462-3504
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 1019-1056
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 1058-1096
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000982
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 20 Region: 2575-2612
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000118
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 21 Region: 3628-3668
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000126
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 1099-1137
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000013
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 23 Region: 3504-3543
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 56-96
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2780-2814
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 172-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 27 Region: 2902-2944
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 3593-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 2946-2985
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 30 Region: 3988-4073
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000314
Family YWTD domain 0.0024
Further Details:      
 
Domain Number 31 Region: 3423-3463
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 32 Region: 3758-3794
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 33 Region: 1183-1219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 34 Region: 3387-3422
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 35 Region: 974-1013
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 36 Region: 2987-3032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.022
Further Details:      
 
Domain Number 37 Region: 3552-3589
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 38 Region: 1140-1177
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 39 Region: 3714-3752
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 40 Region: 3833-3878
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000463
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 41 Region: 1264-1300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 42 Region: 100-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 43 Region: 2654-2694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 44 Region: 4130-4164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000974
Family EGF-type module 0.028
Further Details:      
 
Domain Number 45 Region: 2696-2735
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 46 Region: 2820-2862
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 47 Region: 3801-3840
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000578
Family EGF-type module 0.014
Further Details:      
 
Domain Number 48 Region: 20-55
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 49 Region: 3890-3926,4081-4161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000377
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  H3DNK6
Domain Number - Region: 933-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00023
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DNK6
Sequence length 4218
Comment (tr|H3DNK6|H3DNK6_TETNG) Low density lipoprotein receptor-related protein 2b {ECO:0000313|Ensembl:ENSTNIP00000022105} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RCEGSKDCTDDADELNRPASSCSSEEFKCVTSGECPWGFVCDGEEDCLDGSDEERACGER
TCGSDQFTCQEGQCVPASYRCDHVKDCLDNSDENNCNYPPCTERTCANGACYNNSQHCNG
LQDCRDGSDEFNCTNQHCPIHQFQCANGFCVPLSFVCDHWDDCGDNSDEEGCAYQSCGGH
EFTCSSGRCIPQRWVCDEFNDCGDYSDEKGCDSNSRDCYPGEWGCPGSTVCIKMDRVCDG
KPDCPEGSDETNATAHQTCGLQRCATLSCEYMCHPSPQGGACYCPDGFTVANDSRSCVDY
DDCQIWGICDHLCEDRPGSHQCSCADGYFLEQGHICKANVSGGLPQLIFTNGGDVMMADI
HGRFVRTLVPSQGRGYAVGVAYHWHSSTVFWSDTNTQKVYSANYNGGDIKEILTTAVHSV
QNLAVDWLNFKLYVLETMVERIDVCDFSGANRITLVAENLQSPHGLALDPTVGYMFFTDM
GTATEQVKLERAFMDGSNRVELVKKRLGIPAAITVDIVTKRVYWTDIHFDTVETVTYSGL
DRKIVLNGGTKAPYPFGIATFENHLFFTDWTKMGVMKANRFKENNPELIYRTTRRPGHVV
VSHSVLQPVVMNPCGRHNGGCQHICVLSHRTDNDGLGFRCKCRHGYDLHSDHRTCFKVKD
FLLIASSLAVRGIPLNLSLQEDLTLPLSGLATSFSGSAVEFDGIKESIFYNDRSRGLVYK
SNLNGTGIQEILTGYRVGVIDAMAYDWTSNILFWTTSTYQSVVAFKVTDKSRRDIVTGLR
YPKGIAVHPSAGYLFWSDWYRPAVIMRAFTDGSNAIPLVNTTLGWPYGLALDYITDRLYW
VDSQLDQVGHIDIQGSDRQTFTNIGEITQPYSLTVYTDYLYVADTRTRSIYEMRKRDGGG
SVVVRRGITAIMNIKAYTPELHSSFTSRCTKPPNGQCSHFCFPVPPFSRKCGCPYGMKLQ
DNKRDCIKDDSVPPPDNNCGDNAFECDEGRCRPNSYRCDGIIDCVDKSDEANCTDTGATC
SPLAFTCDNKHCILSGWRCDGLDDCGDGSDEMNCPTKTPTTCSADYFTCDNYRCISKSFL
CDGDNDCGDGSDEHNCNSTITTCPPNYFLCPDHRCIYNSYVCDGDQDCLDGSDEKDCEFA
CASYEFACASGDQCVSSSYRCDGVFDCRDHSDEQDCPTRGPGLCHDDEFQCQNDGFCIPG
VWECDGHSDCEDGSDEHNSCPPVTCRPNYYQCQNKLCIPTSWQCDGDNDCLDMSDEQNCP
TPPFRCPSGQWQCPTDQLCIDLDKVCDGQSDCPNGADESPICNQDDCILNNGGCSDICTQ
GPFGAQCSCPSGFQLLNDSKTCEDINECLIPGFCSQECYNERGSFRCYCSEGYLLEPDGR
TCKAIDTQDAVLLIAKRSQIIANWVNKKPPQMKPVVSGSSIVTVDFDRVTSRIYWADASQ
KKIWSSYQNGTDKREVFSTGLMVPESIAVDWVGRNLYWTDSVMENIEVSTLDGRFRKVLL
SKNVTSPRGLVLDPRNHTNLMFWSDWGQNPRIERAFMDGTVRQVIVSTKLYWPNGLALDY
TTHRIYFADAYLKYIDYCSYDGSNRHQVMASNMVLQHPHGMTIFENYVYWSERYTSKVMR
TNKFHGSNFTTVMSSVYQPMGIVMDHPIKQPTGNFATLNSLCTQLCLLSGLRPRYYTCHC
QSGWKLDADKRTCIKDESTFLMVVRESVIFGIPLDPNDPSNNAMTPVSGISQGQDIDFDD
QEELVYWVQNTGSIWKVKTSGTNRSEFAPAAIMGSPSGLAFDWITRMMFYTNPTGKSIEV
IRVDGSQHYRKTLITSTGKPEETGQPIGIAVDPARGKLFWTDKGSENVPPKVGSADMDGG
NLKNLYTENLANIGVLTADISASKLYWGVSGSGVIECGTMDGLTKVTVVSGLSHPWGLTV
HQNYLYYTDLDYEVIERVDKNSGANMVVMRSGMSGLRALKVHTRDDSAGTDNACSSNNGG
CAQLCLPKPDHQKTCACTTGFIMSPDGTRCEQYESYAVVSTDKYIRGFHINSSDHSEAMV
PISGSSYSVKGTMDLHIQSGFVYYIDNSTYSSYRGIYRTKTSGGFTTRVIGSGIGKLGIQ
GLAVDWITGNLYFTNAFESETLLEVHVINTTNRMILLKSSHDQPRDLAVSPKLRYLFWTD
GGQTPKIERALLDGTNRTVLASESLASPRGLTVDYTNDFLYWTDDVLDMISRMASDGSQR
QIIRYGSRYPSPVGVAILGNNMLWVDKKLGKLFQASKGNTSSAQPEVIRDNLDGLMDIAI
FDVHVQPTASHQVAFNPCYEHNGGCQQLCFAIPDQDHPKCGCAHGSLLSNGVTCGYGLDE
FLVFTTDYTLNSLRLDPADHSVPYPTVDLSYGVKALDYDFKEKRIFFTQYMGIGYSKIGY
ISTTSPTSPPVMIATSFRKTIINSSLTTPNGLSIDYEERMLYWADASLDKIERATLTGEN
RHIILHGVVYPYAMTVFQQDIFWTDWTERAVFRARKDGGSGFAVLAQDLQYRPNDIHVYA
GSKQEMCSSSCQQFNGGCSHICVSGPSGPECQCPHDGSWYLANDGKDCIQDTGKRCQADQ
FTCLNGHCISVSWKCDGYNDCQDNSDELERVCAFHTCSATEFVCDNGRCVPLSYVCDYTN
DCRDNSDERGCPFPTCNPTTEFTCDNGRCISADFICDGHNDCRDNATSDEINCPDRTCPD
GLVKCDHTNICIYPGNLCDGYNNCGDNSDENPLFCETRTCSMNEFRCDSGKCIPNSWVCD
GIRDCQDGTDEPLSCEDQIKTCDPSQFTCTNGNCIPQFMLCDGNNDCWDNSDEAVELDCG
ERTCSSVQFTCPTWIPGFPKCLPISYVCDGERDCANAADELRNCPNRTCHLDEFSCSNGL
CILLPFHCDRVNDCGDGSDELGCTYDTCSSNQFTCTNGACISSAFTCDGMSDCLDGSDEE
DSLCVSPQPTCAPQQYMCTSGQCIDTNRVCDGQKDCPDNSDEKGCGINECTNPSVHKCAQ
LCTDTLTGYYCSCQPGYRLMPDGKACEDINECSSTPAVCSQICENVVGSYYCKCAPGYIR
EADGRTCRQNSGIAPYLLYSNRYYIRNLTTDGSHLSIVLQGLTNAVALDFDHSEKRLYWL
DAGTRKIERMRFDGTDREVLANDVMAAEGLALDWVGRKLYWTDSYYGSVHVMELNGLYQR
KLLSGHFKEGNSTYIISRPRAVAVNPKYGWVYWTDWADMAYIGRAGMDGRNVSAIITTKL
EWPSALTIDYTTNRIFFADSHLNFLDFADMDGQNRHRAVGGTLPHVFAVSLFEDWVYWTD
WNTHTVEKAHKYTGEMRTVMGNNTHRPYDIHVYHPYRQPRSENPCSSHHLTCSHLCLIGP
GGQQASCECPDHFIGLAVGFKIQCVADCSSTQFRCGDNEKCIPIWWECDGQSDCGDGSDE
PQTCPPRYCPVGQFQCQDRNCTHSGFICDGHADCPDHSDEDAALCSDHRCQENQFQCKNK
KCIPVSWHCDGVKDCSDNSDEDPETCSQKTCAPGQFQCANGRCLPSSYVCDFQNDCGDNS
DEPLETCMGPDYKCDETEFSCKTNYRCIPQWARCDGTNDCLDNSDEEGCEDVTCDPLGDF
RCDNHRCIPIRWQCDGNNDCGDGSDERNCQPRPCSESEFRCDSQQCIPATWVCDHMNDCG
DNSDERDCGLKAQHIFISWLSFRATDLSSRFFQCHSGHCMDGSDEQLSLCSTITCEMPSK
FRCANGYCIFAGLLCNQKDDCGDGSDETEDLCREPTLPPCTLDEFKCSNGHCVPLPYVCD
HNDNCGDLTDELGCNFGNDRNCEEKLCQHVCTNLNGTGFICSCKPGYKVNPDSTTTCLDI
DECQIYGTCPQFCKNTKGSYDCECAPGYRKVGDGKMCEAEGEHSLYDSAFNYKCSHNCVI
LCVYTELNLCDFAVALPLLESQNKCLVLQLFIMLMLQFTLVYNNTINMKMQTTLVASLMA
NLCSGAAPLLLLPENIRIREFNLQTEASMIYWSDSKESRIESILPSGEDRRTSVFIDVRN
PFSVCVFEDHVYWSTQEKGEVFRQDKFGRGIKTKLLTGGPWLTQVSVYQQQRYNSMAMKN
PCNGVCSHLCLLRPGGYSCACPQGSSFIPGSKTECDAASEPPATMPPPCQCQNGGTCYFH
DNKALCKCPPGWEGLYCQKHSYTIITSSIGIAIGVTVAIVLLLIVLICVCKRNPKLVDML
RSNLPSMPAMPSMPSVSN
Download sequence
Identical sequences H3DNK6
ENSTNIP00000022105 99883.ENSTNIP00000022105 ENSTNIP00000022105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]