SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DNQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DNQ0
Domain Number 1 Region: 38-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-36
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DNQ0
Sequence length 421
Comment (tr|H3DNQ0|H3DNQ0_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000022149} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MQRWSLRWKTKRWIMDSTLTAFITLFLVLQAARVKAAEPVDVLKVLEFQNNPEGVERTSG
FCVQRRASKPDSAYRVSKPFQISAPTTQLFPDLAGGVFPQDFSILTTLRAKPGLQSFLLS
IYNEQGVQQLGVEVGRSPVFLYEDQNGKPAPEDYPLFKAFSLADGKWHRVAISVEKNTVT
IILDCKKKLTKPLPRSDNASIDTNGITVFGTRFLDADVFQGDIQQLLIADNPGAAYNYCE
HIPDCETPHSDSMQAQEPEKEPNNVEGDYNTDIDFGTLDDTQTQSPFTTSGPNEEDAVGE
FVTEATPFASEPTIVPETVDELDTGTDAYDFKEYDLKEYDLGEVDGRLYDYGAYDEYGTA
TPKLTATEDEVGPGVAAETDISENTIAGIGEAFGQKGEKGEPAVIEPGMLIEGPPGPPGP
S
Download sequence
Identical sequences H3DNQ0
ENSTNIP00000022149 ENSTNIP00000022149 99883.ENSTNIP00000022149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]