SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DNQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DNQ3
Domain Number 1 Region: 370-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000598
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 300-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.089
Further Details:      
 
Domain Number 3 Region: 426-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000561
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  H3DNQ3
Domain Number - Region: 479-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000636
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 93-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00842
Family APC10-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DNQ3
Sequence length 516
Comment (tr|H3DNQ3|H3DNQ3_TETNG) Netrin G1 {ECO:0000313|Ensembl:ENSTNIP00000022152} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=NTNG1 OC=Tetraodon.
Sequence
MRFHLLLLLLQALWAGVCQAAMQHYPAAWGHYDVCKSQVYSDEGLTWDYMACQPEAADMT
QYLKVTLDPPNITCGDPPETYCALENPYMCNNECDASTEELAHPPELMFDIEGRNPTTFW
QSTSWKKYPKALLVNITLSWNKTIELTDDIVLTFESGRPEQMVLEKSLDYGRTWQPYQFY
ATDCLDAFTMEPKTVQDLTQHTLLDIICTENYSRGYVWKYDKTVRFEIKDRFALFAGPQL
HNMASLYGQLDTTKNLRDFFTITDLRIRLLRPATGATMVDENKLSRYFYAISDIKVQGRC
KCNLHANSCVFDKEKLSCECEHNTTGPDCGRCKRNYQGRAWSAGSYLPIPKGTANICCNI
PKITKPKNYCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCQQCKLGYYRNASAELDDE
NVCIECNCNPFGSVSDRCNGTGFCICKEGTTGPKCQHCLPGYLWSNGCKSRVCDNELLRC
QNGGVCINNLRCNCPAAYTGLQCEKRRCETELGGCG
Download sequence
Identical sequences H3DNQ3
99883.ENSTNIP00000022152 ENSTNIP00000022152 ENSTNIP00000022152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]