SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DNQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DNQ5
Domain Number 1 Region: 192-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-53
Family DBL homology domain (DH-domain) 0.000000366
Further Details:      
 
Domain Number 2 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 4e-32
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 3 Region: 2-216
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.58e-29
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 4 Region: 635-765
Classification Level Classification E-value
Superfamily SH2 domain 1.2e-27
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 5 Region: 784-845
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-22
Family SH3-domain 0.00074
Further Details:      
 
Domain Number 6 Region: 588-664
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000134
Family SH3-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DNQ5
Sequence length 850
Comment (tr|H3DNQ5|H3DNQ5_TETNG) Vav guanine nucleotide exchange factor 3 {ECO:0000313|Ensembl:ENSTNIP00000022154} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=VAV3 OC=Tetraodon.
Sequence
MEYWKQCSLWLINCKVLPPNHRVTWESAQVFDLAQTLRDGVLLCHLLNNLRPQTINLKEI
NLRPQMSQLLCKWNLGGLLSSPCIFGCRRSFFNEAICRFSCAETGKVVDTLSKLSHTGIA
QQTGIRPFPSEESVEDEDIYNHLEDLIDEKLVEDEEDLYDCVYDDEDGGEIYEDLMKTEA
LPPPPFHKQAEIDIRSCCLTEIKQTEEKYTETLESIEKHFMFPLTSYLSAAEIESVFVNI
PDLVKVHKCLLLDIQESLHHRSAQNLYQIFLNFKERLLIYGKYCSHVETAIGTLDQLCKD
REDIRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLRLAL
DAMKDLAQYVNEVKRDNETLREIDQYQKSIENLNQALSKYGRPKGDGEVRVASVDKRAKQ
DRHIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKETRKWSYGFYLTHKQGQS
GFEFFFKTKELKKKWLEQFGMACLSNILPENASNNFHDFHMHTFERITSCNSCHMLLRGV
FNQGYLCSRCGLGAHKECLGRFGCCGKTEHTQTNKSRTQKHSRPRRDGNRSDSCLPKMLV
IRSYFGAPSPASGPALNIQAGDIIELLCADIHSAWWQGRILSTKEVGFFPSDAVKPCPCV
PKPVDYSGQPWFAGPMERLQAEAELINRVNSTYLVRHRSREYTEYAISIKYNNDVKHIKI
LTKEGCFYIAENKKFRSISELIEYYKHHSLREGFRSLDTTLHFPYRELENAAMQRLNRPG
SNMLTPKVIGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVHGRVGWFPST
YVEEVCSDLC
Download sequence
Identical sequences H3DNQ5
ENSTNIP00000022154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]