SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DP57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DP57
Domain Number 1 Region: 14-120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 2 Region: 184-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000811
Family Spermadhesin, CUB domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DP57
Sequence length 267
Comment (tr|H3DP57|H3DP57_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000022306} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
HFCSLVFLGFIHTCGGNLKGRNGTIESPGFPYGYPNGANCTWVIVAEEGNRIHIVFQSFA
VEEEYDFLSLYDGPPHPANFRTKLTGFTIPPPVTSSGSVFSLRLTSDFAVSAHGFKVVYE
DVPAYNAPNPLINTCCIHRTKFSVSTPLNLGCPANSVLFGHAVLRCSFSYTCNTGFSVSP
IPASAEDTCGGTLRGSSGLISSFDFPGGESPGTGAGGGAGGLGTSGECKWTVLADPGDTI
SLVFTEFQMEEKSDYLEVEGSEPPTIW
Download sequence
Identical sequences H3DP57
ENSTNIP00000022306 99883.ENSTNIP00000022306 ENSTNIP00000022306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]