SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DPA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DPA8
Domain Number 1 Region: 473-667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-43
Family SPRY domain 0.0088
Further Details:      
 
Domain Number 2 Region: 407-502
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 190-250
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000305
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 3-41
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000129
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Weak hits

Sequence:  H3DPA8
Domain Number - Region: 138-173
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0439
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DPA8
Sequence length 671
Comment (tr|H3DPA8|H3DPA8_TETNG) Tripartite motif containing 67 {ECO:0000313|Ensembl:ENSTNIP00000022357} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=TRIM67 OC=Tetraodon.
Sequence
QAAMEEELKCPVCGSFFRDPILLPCSHSVCLACARNISVQTPEGETPVQSRASGSSDYDY
LDMDKMSLYSETDSGYGSYTPCQKSPNGVRVVPTGPPQRHCSLTCPLCHRSVSLDERGLR
GFPRNRLLEAIVSRYQQNPVKCQLCDRNPVDAAVMCEQCDVFYCHACQQRCHPSRGPLAK
HRLVPPRKPTAKPATCADHEAEQLSVYCPSCRCAVCARCLEEGKHAKHDVKPLAAVWKQH
KCQLSQALNGISDKAKDAKEFLVQLKNLLQQIQEGGVEFEACLVAQCDSLIDALTRQKAK
LLTKVTKEKEYKLKVVRDQITHCTMKLRQTTGMMEYCLEVLKENDPSGFLQISDALIKRV
TSSQEQWVKGALEPKVGPEFDLTLNTDSLMQTILQLDFCQSKVESGPSVPGAPLLQLEKC
CAGNNSATLAWRVAAPPGNPIEGYILELDDGNGGQYREVYVGKETVCTVDGLHFNSSYNA
RVKAYNAVGLGPYSKTVVLKTSDVAWFTFDPTNAHRDIVLSNENRTVSCNSYDDRVVLGT
AAFSKGAHYWEVSVDRYDNHPDPAFGVARINTVKDMMLGKDDKAWAMYVDNNRSWFMHNN
SHTNRRTEGGIAKGSTVGILLDLTKHTLTFYINKEQHGPTAFESMDGVFVPAVSLNRNVQ
VVTLLTGLELP
Download sequence
Identical sequences H3DPA8
99883.ENSTNIP00000022357 ENSTNIP00000022357 ENSTNIP00000022357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]