SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DPC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DPC5
Domain Number 1 Region: 25-214
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.63e-44
Family Astacin 0.00047
Further Details:      
 
Domain Number 2 Region: 381-546
Classification Level Classification E-value
Superfamily TRAF domain-like 7.85e-39
Family MATH domain 0.00089
Further Details:      
 
Domain Number 3 Region: 222-384
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-25
Family MAM domain 0.0033
Further Details:      
 
Domain Number 4 Region: 618-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000369
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DPC5
Sequence length 700
Comment (tr|H3DPC5|H3DPC5_TETNG) Endopeptidase-2 {ECO:0000256|PIRNR:PIRNR001196} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LNLGSNANLFEGDIVIPKGRNALLDQKYRWKFPIPYILGDDLDLNAKGCVHQAFEMYRLK
SCIDFKPYEGEKTFIKFEKRDGCFSSVGDQQTGQILSLGPGCDHKAVIEHELLHAVGFYH
EQSRTDRDDYVDIWLDQVLPGLGHNFNKYNDDFITDQNTPYDYESMHYRPFSFNKNDSIP
TITTKIPEFYNIIGQYLDFSEMDTLRLNRMYNCSGPLTLLDQCTFEKASICGMIQTSSDD
ADWVHRKSIVGSEDHTLLGRCKDAGYFMHFNTMAGKPQESALLESRILYPKRKLQCLQFF
YKMTGSLKDKLVIWVKMDDGTGTVRKMKKIHTFNADADHTWKIAHVPMEVGVKFRYAFQA
VRGDPSASAGGIYIDDISLSETRCPNAVWRIQNFSKIMETATRHTVLHSPRFYSPEGYGY
GVRLVPLSNYTDYTGNYTGLYFHLASGENDAVLQWPAINRQATLVVMDQDPDIKLRMSTA
RSLTTDMRTSDGKLLWDDPSKVGTYDPSCDCHRGVSWGWRNFVKHFDLRRRNYLKNDDLI
IFIDFEDISSLIKTEVPIKPVELNAKGVILQAFEEYRLRSWSGRMMARETQTVSGKSTPS
LVRKSSQNRGQNPSKDYGWSTFMSHNPCHPNPCVNGGVCVERGGEASCRCASAQTSYFTG
KMCENTKMDGSVQGALIGGTVGILLLTLTIFTVINQTKKK
Download sequence
Identical sequences H3DPC5
ENSTNIP00000022374 99883.ENSTNIP00000022374 ENSTNIP00000022374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]