SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DPJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DPJ4
Domain Number 1 Region: 12-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.8e-27
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DPJ4
Sequence length 528
Comment (tr|H3DPJ4|H3DPJ4_TETNG) Ankyrin repeat domain 34C {ECO:0000313|Ensembl:ENSTNIP00000022443} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=ANKRD34C OC=Tetraodon.
Sequence
MADILELRTDGNSLLKAVWLRRLRLTRLLLEGGAYINESNERGETPLMVTCMSTHSDQQS
VSKAKIVKYLLDNQADPNIQDKAGRTALMHACMHKAGHEVVDHLLSNGADPSLEDRSGAS
ALVYAINADDKETLKLLLDACKAKGKEVIIITTGKSPSGTKTTKQYLNVPPSPGLDERSS
PTCTSPSEIEVTAFPTNKQEEQNTVFSFQAKLKSSGAAKLANGPTSPTRRPVNPKRARLP
QLKRLQSEPWGLIAPSVLAAAAAATMSRKAGSDEDVVVGVNGLSLSKRSALSRQNSVDGK
DSLFPKVGEQPCKMTPSLSVPLTSKASYERSLGQHQPLARRSTIPTEQEGGGCLSSGPPS
LRDTMHRRRLGNDHYDSDSQLYSDSGMLDSPKIPAERRKLNTSPLAMLTGSRESLDSSAG
ISSPSTVHRRIPGLLERRGSGTLLLDHISHTRPGHLPPLNVNPNPPIPDIGASSKPSSPL
ATGIRSIAPVAPNTPKRGGLKSKKKLVRRHSMQVEQMKQLYDFEEQAH
Download sequence
Identical sequences H3DPJ4
99883.ENSTNIP00000022443 ENSTNIP00000022443 ENSTNIP00000022443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]