SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DPN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DPN5
Domain Number 1 Region: 625-758
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-30
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 
Domain Number 2 Region: 1183-1306
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-17
Family Second domain of FERM 0.0069
Further Details:      
 
Domain Number 3 Region: 766-879
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000525
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  H3DPN5
Domain Number - Region: 1076-1153
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000116
Family Ras-binding domain, RBD 0.084
Further Details:      
 
Domain Number - Region: 15-52,662-682
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0199
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DPN5
Sequence length 1441
Comment (tr|H3DPN5|H3DPN5_TETNG) Pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 {ECO:0000313|Ensembl:ENSTNIP00000022484} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
RCAALEMQLLRFRIQAGKIRELLAEKMQELEEKVTEADQRADDAEKQVRVMEEKLKSANI
QTSESESPLYRKHQDLTIRVQEKDAVIQRLEAQVLARAQEAKVIEEKAGKIKDWVTLKLK
EMEQENQQLKMANLKQAEQILLLQDKLQDTSRFSRFSRFSRFRVFLLALISPFSGPQRSW
RSLPVPDLPPPLLWPPPLPAVRSGRPAAPGLRLPRRTAGDTPAPAEPKPCRQILKPDSAG
YDLGCEKVTCASASTRANKDNVLVLSSDVRRTPEHSVKGICLGELSAHHAPVWNAGLATP
APRPEPSISPRCPPGGSDRDNSSDELNDKFRSQCLHSSTSSSSSSSACEAAHGPSPPESA
GGPASLSRSPSTSNPFPTGPSQRSGASTTLPKVRTPLTPRDSVQLAKKHSSQPQPSLDRL
RPPSAASSTASSTLKSSGAATPAFSQVIEETDIDDGLDGMDGVLEGPGADPLRDGVSFVG
LAEELELLDQDATKPPTPPLHRFPSWESRIYAVAKSGMRVSEAGPGARSPGQGSSLPQFS
ATGPFSQLIHRNVGVPVYTALKGKATQISSVPLAEDESGSEDDSSSLAGSRSSIISPDRK
GSVPGSPRAVKRGVSMSSVSSESDYAIPPDACSLDSDYSEPEHKVQRTSSYSCESTGPEV
LEKSGYLLKMGNRVQAWKRRWFILRNGGILYYKSPSEVIRKPQGQIQLNSCCRLLRGEGA
QTFQLITEKKTFYLTADSPNILEDWIRVLQNVLKVQASGPLPVATAAKPSVRGWLTKVQT
RRHSKLVWCSLVGKVFSYYRVQEDKLPLGQLQMHQASVQEVDRSCDSDEDYEVGGRGFLS
SHCTLVVKPREQSPTYLLIGTRQEKDTWLYHLTVAAGSSATFRVGTEYEQLIGELLDADG
DPESALWRSEALSFTKEGLRSPLTTLPSEALQTEALKLFKSCQLFINVLVESPSVDYHTS
LAQNALQVCLTHPELQNEMYCQLIKQTNQRTPHNHSLTQCWQLLSLCVALFLPQQHVLWY
LKQYLRRNADPRSEVGKYAVYCQRSVERTQRNGERESRPSRMEIVSILLRNPYHHSLPFS
IPVHFTNSTYQVVGFDGSTTVEEFLLTLTQRIGARRPQLSGFALFTDDPSGRDPEHCLHP
SAKICDVISKWEQALKELHPGKNEGTRIVRLTYKNRLCFRAQAKGETERERLLLVYQVND
EVQQGHFPVNKELALEVAALLAQVEHGDLEKPAGFSAAGPPQAKSQLVLLQVLDRFYPKR
YRQDCSSEQFRDLLERLAHKWSTLRGCGASECVRTYLTVARKWPLFGAKLYSAEPVPPCP
VEETQVWLAVNEDGLCVLDLTMNPLVSYPYQGVVTFGGCRDDFMVVTSQQGEPGVGRRSV
EKLVFAMAKAKILELTLLMADYMNHRNPGVPPASHRPGGQWEADSRHVPARTPSTKGPTL
L
Download sequence
Identical sequences H3DPN5
99883.ENSTNIP00000022484 ENSTNIP00000003465 ENSTNIP00000022484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]