SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DQE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DQE2
Domain Number 1 Region: 72-196
Classification Level Classification E-value
Superfamily vWA-like 1.5e-35
Family Integrin A (or I) domain 0.0000483
Further Details:      
 
Domain Number 2 Region: 328-380
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000199
Family Integrin domains 0.0027
Further Details:      
 
Domain Number 3 Region: 492-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Integrin beta EGF-like domains 0.0022
Further Details:      
 
Domain Number 4 Region: 450-488
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number 5 Region: 421-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DQE2
Sequence length 548
Comment (tr|H3DQE2|H3DQE2_TETNG) Integrin beta {ECO:0000256|RuleBase:RU000633} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
DFLNGAASGRRCDLPENLLARGCEVEVMERWETRVEVNTTVSGTQVSPRDISVTLRPGSE
ASIVVEVKQLHRYPVDLYYLVDVSASMQENLDHLKTVGVALTLRMTEHTSDLWLGFGSFV
DKPVSPYINVHPSKISNPCSSDYEIRCRPAHGFHHVLSMTGNMSEFTRVIKRQRISGNMD
TPEGGLDAMLQAAVCQVGTQHTNALMPDSSGACARLLALINHLVGVENEKWCRLSRHWIY
SCSGVQPNQTVTFTGCACMRTDGAFIFGAACAAAVPAPLIHKIGRTSGPFFFFLRLSGFE
TYKPPYTLKLNCIFTVNNLSSMIEIPAKISPNTYFKITFGLRSCPDDGQDEHVNVLVRPV
GYNESTVVRIHSKCGCGCGATKRCNDDSQTLCSGMQDSKKVSNPNLTDSDRGLNWSCRPE
AADVDCSGRGVCECGRCVCDRTKVYGKYCEMDDFSCPYHGGLLCGGRGTCVLSECACADG
WTGESCGCPVSTATCQSANGLLCSGRGRCTCGKCVCDDPQYSGEVCQRCPACQSTCQAHW
KCVDCHLS
Download sequence
Identical sequences H3DQE2
ENSTNIP00000022741 99883.ENSTNIP00000022741 ENSTNIP00000022741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]