SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DQE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DQE3
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-62
Family Fibrinogen C-terminal domain-like 0.00000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DQE3
Sequence length 158
Comment (tr|H3DQE3|H3DQE3_TETNG) Angiopoietin-like 2b {ECO:0000313|Ensembl:ENSTNIP00000022742} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QQGFGNIDGEYWLGLENIYWLTNQGNYKLLITLEDWSGRKVFAEYASFRLEPEADFYKLR
VGRYHGNAGDSLTWHNGKQFTTLDRDHDAYTGRNCAHYQKGGWWYNSCAHSNLNGVWYRG
GHYRSRYQDGVYWAEFRGGAYSLKKVVMMIRPNPNTFH
Download sequence
Identical sequences H3DQE3
ENSTNIP00000022742 99883.ENSTNIP00000022742 ENSTNIP00000022742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]