SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DQE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DQE4
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-38
Family Galectin (animal S-lectin) 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DQE4
Sequence length 135
Comment (tr|H3DQE4|H3DQE4_TETNG) Galectin {ECO:0000256|RuleBase:RU102079} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=LGALS2 OC=Tetraodon.
Sequence
CLQLLELKNVRLRTGDQLKIKGFVLKDADRFRINLGSDEENLALHFNPRFSDTTDESVLV
FNSRKAGSWGEERKESPNPLHRGRDAKIVLKLAGDVFKVELPDGHKFIFPNRENVDVISY
IGIGGDFKLTSFKIC
Download sequence
Identical sequences H3DQE4
ENSTNIP00000022743 99883.ENSTNIP00000022743 ENSTNIP00000022743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]