SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DQS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DQS6
Domain Number 1 Region: 32-126
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000366
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DQS6
Sequence length 242
Comment (tr|H3DQS6|H3DQS6_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000022875} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
QGDQPMEDIEGMEEVFATLSAMKTEVELMRRPLGTFESPARTCKELMMVQTNNKDGDYWI
DPNQGCHRDSVKVYCNFTADGETCLYPDKRIEMVKLAAWNKETPGSWYSQFRKGKQFSYV
DSDGNPVDVVQMTFLKLLSATAKQDFTYTCQNSAGWFDKASDSYQHALRFRGSNDEELTQ
AKSPFISVVYDGCQSRKGQERTVLEIDSPSAEILPIMDIAASDFGNSNQKFGFQVGRVCF
NG
Download sequence
Identical sequences H3DQS6
ENSTNIP00000022875 99883.ENSTNIP00000022875 ENSTNIP00000022875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]