SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DRE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DRE5
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.31e-21
Family Ankyrin repeat 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DRE5
Sequence length 87
Comment (tr|H3DRE5|H3DRE5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000023095} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAVLKLAEQPPLIQAIFSGDPEEIRMLIYKSEDINALDAEKRTPLHAAAFLGDAEIAELL
ILSGARVNAKDSMWLTPLHRAVASRSE
Download sequence
Identical sequences H3DRE5
ENSTNIP00000023095 99883.ENSTNIP00000023095 ENSTNIP00000023095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]