SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DSS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DSS6
Domain Number 1 Region: 9-109
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-28
Family SH2 domain 0.00058
Further Details:      
 
Domain Number 2 Region: 106-153
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000761
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3DSS6
Sequence length 161
Comment (tr|H3DSS6|H3DSS6_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA00457} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00090011 OC=Neodiplogasteridae; Pristionchus.
Sequence
MDDYVNTEVTAQEWYMGELSREESEARLRGTPNGMYLVRFSPKKHQYVISISYAGEVKHT
VIENPTAATYYLDETTTFPSIVELINYYRENNLRESFNALDTKLTKPHRECKTFRANHPY
KATEPKFLELRVGDLITLVDTMGEERGWWKGKIGERITENQ
Download sequence
Identical sequences H3DSS6
PPA00457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]