SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DXV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DXV8
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000000046
Family BAR domain 0.022
Further Details:      
 
Domain Number 2 Region: 159-216
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000816
Family SH3-domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DXV8
Sequence length 218
Comment (tr|H3DXV8|H3DXV8_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA02254} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00091808 OC=Neodiplogasteridae; Pristionchus.
Sequence
AEAEVRVAQAEFDKQTEITKLLLEGIQTAHNNQLKCIRDFVEAQLSFYAQAHQSLADLQR
DLSGSSDGPLLLRRRTVVNDERDEYRSIDSHSTTVSPPPTPESYHDDSYDRTAEYGNYRT
LSFRGATVTTTVVDVMKEQNGEKKKSLTGIYSALSDGGTKQARVIMDYDAVLRDELSVRL
NEVIIVYRLPGMDEDFVMAERAGVRGRIPIEYIEIVYV
Download sequence
Identical sequences H3DXV8
PPA02254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]