SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3DYR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DYR3
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-20
Family SH3-domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DYR3
Sequence length 111
Comment (tr|H3DYR3|H3DYR3_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA02561} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN= OC=Neodiplogasteridae; Pristionchus.
Sequence
MLKSSPPSNKAEPVSPPEPQRVVSPASQSVSLGGRTVTGAGQAGFAVKAIYDYTAADKDE
ISFIEGDIIVNCAKVDDGWMTGTVQRTLQWGMLPANYVEPYKQPTGLHRIH
Download sequence
Identical sequences H3DYR3
PPA02561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]