SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3E7F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3E7F7
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-22
Family SH2 domain 0.000051
Further Details:      
 
Domain Number 2 Region: 80-116
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000481
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3E7F7
Sequence length 120
Comment (tr|H3E7F7|H3E7F7_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA05644} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00095198 OC=Neodiplogasteridae; Pristionchus.
Sequence
MDAEVLLRKQGTHDGAFLVRQCESSPGDFSISVKFEDRIQHFKVLRDNSGKYYLWVVKFS
SLNELVNFHRTSSVSRNQNILLKDMALETQFVQALFDFNPQEDGELAFRRGDIITRQKRP
Download sequence
Identical sequences H3E7F7
PPA05644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]